SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0042 - 3402424-3402534,3403242-3403345,3403448-3403562,340...    30   1.4  
03_05_1133 - 30614901-30615389,30615823-30615933,30616113-306161...    29   4.2  
01_06_1451 + 37451004-37451113,37451422-37451661,37451765-374518...    28   5.5  
11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600           28   7.3  
05_07_0119 - 27821145-27821288,27821612-27821722,27821848-278219...    28   7.3  
03_05_1045 - 29914581-29914829,29914840-29916083,29919055-299191...    27   9.7  

>09_02_0042 -
           3402424-3402534,3403242-3403345,3403448-3403562,
           3404344-3404391,3404519-3404608,3404819-3404893,
           3405001-3405153,3405695-3405779,3408051-3408121,
           3408243-3408293,3409037-3409453,3409529-3409660,
           3409779-3409892,3411113-3411179,3411264-3411397,
           3411486-3411701,3412627-3413418
          Length = 924

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 19/52 (36%), Positives = 22/52 (42%)
 Frame = +1

Query: 472 RG*PGTSLPSPCCHQEGSRRPDTGTLRSASTLARS*QKHGGVRRGGSFG*HT 627
           RG P  S P+P   QEG RR       SA  +A       G RR    G H+
Sbjct: 78  RGDPSVSAPAPAAGQEGHRRRSGRGKHSAEAMAVPAAGQEGHRRRSGRGKHS 129


>03_05_1133 -
           30614901-30615389,30615823-30615933,30616113-30616178,
           30616347-30616406,30616493-30616801,30616960-30617108,
           30617200-30617269,30617370-30617494,30617516-30617573,
           30618176-30618370,30618585-30618857,30618950-30619120,
           30619203-30619333,30619423-30619582,30619712-30619900,
           30620023-30620118,30620381-30620611,30620715-30620853,
           30620903-30621057,30621160-30621378
          Length = 1131

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = +1

Query: 397 YNSLDHAAGL*KIPPWSCKSRIRRRRG*PGTSLPSPCCH 513
           Y++L++   L  +P W  K+  R+RRG  G   P  C H
Sbjct: 632 YDALNNTPCL--LPSWISKASARQRRGRAGRVQPGECYH 668


>01_06_1451 +
           37451004-37451113,37451422-37451661,37451765-37451846,
           37452159-37452200,37452285-37452344,37453020-37454663,
           37454763-37454864,37455846-37455986,37456077-37456202,
           37456376-37456543
          Length = 904

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 4/50 (8%)
 Frame = +2

Query: 443 GHANPGSGVAEADLVQASPHRAVIKKVH---DAQI-LAPFVQLVHWLVHD 580
           GHA  G+     D V A  H+A+ ++VH   +  I  A    L  W+VHD
Sbjct: 85  GHAADGAAGHSHDRVDALVHKAMAQQVHVVGEGVIGQAALTGLHRWIVHD 134


>11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600
          Length = 251

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = -3

Query: 623 CHPKLPPR-RTPPCFCHERASVLAERRVPVSGRR 525
           C   LPP  + P C C +R  ++A R   + GRR
Sbjct: 17  CVYLLPPWCQRPLCLCGDRCQLMASRNPDIRGRR 50


>05_07_0119 -
           27821145-27821288,27821612-27821722,27821848-27821958,
           27822207-27822278
          Length = 145

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +2

Query: 227 AKLVLVAPCDSCSCYGSV*KNVAKAVFP 310
           A L LVA C+ C+CY    + V  A  P
Sbjct: 31  AALELVASCEDCTCYADAIRKVPGAYQP 58


>03_05_1045 -
           29914581-29914829,29914840-29916083,29919055-29919199,
           29919727-29919792,29919882-29920108,29920204-29920310,
           29920428-29920502,29920600-29920688,29920768-29920848,
           29921631-29921702,29922056-29922178
          Length = 825

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -2

Query: 522 TFLMTAR*GEACTRSASATPDPGF 451
           T + TAR G AC R++ + P P F
Sbjct: 336 TAIPTARAGRACVRTSPSKPSPSF 359


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,561,953
Number of Sequences: 37544
Number of extensions: 445078
Number of successful extensions: 1032
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1000
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1032
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1596695220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -