SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0491 + 3506425-3506427,3506610-3506810,3507517-3507732           30   2.4  
03_02_0104 + 5645285-5645677,5645990-5646034,5646225-5646454,564...    29   4.1  
06_01_0465 - 3304417-3306834                                           29   5.4  
01_01_0307 + 2513678-2513772,2514064-2514682                           29   5.4  
11_01_0319 - 2396835-2396951,2397035-2397105,2397219-2397297,239...    28   7.2  
06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422...    28   7.2  
12_01_0906 + 8799284-8799441,8800865-8801690,8801933-8802055,880...    28   9.5  

>06_01_0491 + 3506425-3506427,3506610-3506810,3507517-3507732
          Length = 139

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +3

Query: 429 ISTWGGNQS-SVDILIKPNVVENIT 500
           I  WGGN   SVDI + PN ++N+T
Sbjct: 8   IGPWGGNGGGSVDISVPPNSLKNVT 32


>03_02_0104 +
           5645285-5645677,5645990-5646034,5646225-5646454,
           5646549-5646624,5646705-5646781,5646960-5646990,
           5647058-5647210,5647287-5647421,5647526-5647606
          Length = 406

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 154 INELQPGEEWPQRNSVRQPVADDQTEQTLTEDFSLTIRP 270
           I++LQ G +W    ++R    DD  E+  T     TI+P
Sbjct: 357 IHDLQAGRKWSNLRAIRSKYEDDAFERVSTIPSPNTIKP 395


>06_01_0465 - 3304417-3306834
          Length = 805

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +3

Query: 309 TIERDHEPKKIDYSGSQVWQVSTTKSGA 392
           T  +D     +DY+G+ VW  +TT +GA
Sbjct: 98  TFRKDGGLALVDYNGTVVWSTNTTATGA 125


>01_01_0307 + 2513678-2513772,2514064-2514682
          Length = 237

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = -3

Query: 124 PPRTTRPFASWIPWLLNVKFGFDCRAGSGG 35
           P R  +P A W+   LNV   FD  +GSGG
Sbjct: 73  PRRWEKPHAGWMK--LNVDGSFDLNSGSGG 100


>11_01_0319 -
           2396835-2396951,2397035-2397105,2397219-2397297,
           2397417-2397458,2397670-2397723,2397836-2397868,
           2397959-2398039,2398144-2398230,2398313-2398388,
           2398633-2398808,2398912-2399034,2399249-2399361,
           2399521-2399632,2400054-2400273,2401986-2402314,
           2402408-2402713,2403580-2403878,2404079-2404181,
           2404266-2404369,2404840-2404906,2404911-2405076,
           2405241-2405956
          Length = 1157

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +1

Query: 631 METVSQIRRHLRLYGLLGKTYPSIISVKSIGNHLKVEILRYSAYKR 768
           +E  SQ R +LR YGLLG+ +  I  V    N  K  + +YS   R
Sbjct: 493 LECCSQERTYLRYYGLLGQRFCMINKVYQ-DNFEKCFVQQYSMIHR 537


>06_03_0750 -
           24140988-24141037,24141108-24141345,24142158-24142232,
           24142345-24142413,24142550-24142581,24143503-24143583,
           24143791-24143851,24144135-24144275,24144372-24144563
          Length = 312

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/47 (27%), Positives = 21/47 (44%)
 Frame = +1

Query: 151 LINELQPGEEWPQRNSVRQPVADDQTEQTLTEDFSLTIRPQPQLLKM 291
           L + LQP  +W +R     PV  + +      D + +    PQLL +
Sbjct: 260 LAHPLQPPSQWEKRTDTNPPVFSNSSSSLFGYDLASSALIGPQLLSL 306


>12_01_0906 +
           8799284-8799441,8800865-8801690,8801933-8802055,
           8802144-8802210,8802611-8802714,8802798-8802900,
           8803103-8803401,8804009-8804263,8805471-8805776,
           8805866-8806194,8806829-8806916,8807027-8807164,
           8807438-8807458
          Length = 938

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +1

Query: 631 METVSQIRRHLRLYGLLGKTYPSIISVKSIGNHLKVEILRYSAYKR 768
           +E  SQ R +LR YGLLG+ +  I  V    N  K  + +YS   R
Sbjct: 653 LECCSQERTYLRYYGLLGQRFCMINKVYQ-ENFEKCFVQQYSMIHR 697


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,784,628
Number of Sequences: 37544
Number of extensions: 388387
Number of successful extensions: 1174
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1124
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1173
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2075009728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -