SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0965 - 22996575-22999112,22999202-22999636,22999717-229998...    31   0.81 
01_05_0269 + 20258338-20258536,20258570-20258727,20258777-202588...    31   1.1  
01_06_1179 - 35161229-35162368                                         30   1.4  
12_02_1074 - 25849280-25849324,25849435-25849506,25849601-258496...    29   3.3  
02_01_0459 + 3298780-3298788,3298900-3299037,3299174-3299207,329...    29   3.3  
01_05_0751 + 24904854-24905640,24905747-24905805                       29   3.3  
05_01_0048 + 331155-333077,333208-333354,333540-334087,334481-33...    29   4.3  

>07_03_0965 -
           22996575-22999112,22999202-22999636,22999717-22999801,
           22999888-22999957,23000050-23000293,23000396-23000482,
           23000655-23000706,23000830-23001226,23001324-23001648,
           23001748-23001914,23002007-23002547
          Length = 1646

 Score = 31.1 bits (67), Expect = 0.81
 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 4/68 (5%)
 Frame = +2

Query: 398 VRAHRPLDSCSACCPHRKWLHASIHSADRYKRNNAKIIASKGKLPPPSNAAS----TPNT 565
           VRAH PL    A          S+ S D+   NNA +  S  +  PP++ A      PN 
Sbjct: 742 VRAHAPLQEAKAPSMATSPFQGSL-SKDKAAMNNAAVAESSQRKQPPAHEAQQPGPVPNM 800

Query: 566 AIAPPLIF 589
              P  IF
Sbjct: 801 LQGPAFIF 808


>01_05_0269 +
           20258338-20258536,20258570-20258727,20258777-20258899,
           20259176-20259310,20259380-20259479,20259572-20259945,
           20259994-20260143
          Length = 412

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +1

Query: 460 RVDSLRRPVQKE*CKDYSQQRKAAPAFKCGLNTEYGHRPSPYFPLDSSIG 609
           R+DS +RPV     +D  ++  A   +KCG   +  H  + Y  L+   G
Sbjct: 87  RLDSQKRPVDSRDVRDGKEEEFAKKCYKCGKKGKSSHISTNYPDLNKEEG 136


>01_06_1179 - 35161229-35162368
          Length = 379

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = +2

Query: 464 SIHSADRYKR--NNAKIIASKGKLPPPSN--AASTPNTAIAPPL 583
           S+ SA R K   N  +I+A K K PPP    AA +P     PPL
Sbjct: 265 SVSSARRLKTRANTPRIVAKKSKPPPPPPPAAARSPAPTTKPPL 308


>12_02_1074 -
           25849280-25849324,25849435-25849506,25849601-25849663,
           25849756-25849865,25850648-25850761,25851601-25851681,
           25851736-25851850
          Length = 199

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = -3

Query: 186 VAHGETRNAIRYPNGKEADNCTQMFHCFDITAPTPG 79
           V HG  RN + YP G  +  C  + H    TAP+PG
Sbjct: 6   VCHG-CRNILLYPRGAPSV-CCAVCHAVSSTAPSPG 39


>02_01_0459 + 3298780-3298788,3298900-3299037,3299174-3299207,
            3299528-3299531,3299814-3299949,3300034-3300090,
            3301689-3301786,3301876-3301947,3302056-3302228,
            3302552-3302698,3303113-3303336,3305300-3305306,
            3305634-3305800,3306033-3306068,3306787-3307004,
            3307115-3307172,3307761-3307842,3308045-3308207,
            3308594-3308598,3308700-3308885,3308969-3309548,
            3309642-3309774,3309880-3309948,3310184-3310395,
            3310654-3310891,3311228-3311386,3311501-3311926,
            3312010-3312447,3312593-3312712,3312784-3313266,
            3313471-3314009,3314178-3314667,3314836-3314904,
            3315735-3315839,3315940-3316158,3316254-3316508,
            3316602-3316651,3317175-3317284,3317372-3317454,
            3317560-3317772,3317870-3318040
          Length = 2391

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 12/81 (14%)
 Frame = +1

Query: 112  KHLC-----AIISFLPIRISDCVTSFTM----GDSLLKEDP-LSRIQR--EIIEVTERER 255
            KHLC     ++   LP ++ DC+T F      GD L+KEDP ++++ R  E  E      
Sbjct: 1563 KHLCEKFGASLFEKLP-KLWDCLTEFLKPVKTGDDLMKEDPSIAQLGRSCEDKEPQSLIN 1621

Query: 256  NLKKVTSESTGLCPNLRSTLI 318
            N++ V S +  L   LR  L+
Sbjct: 1622 NIQVVRSVTPHLAEPLRPQLL 1642


>01_05_0751 + 24904854-24905640,24905747-24905805
          Length = 281

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 529 APAFKCGLNTEYGHRPSPYFPLDSSIGTSSFP 624
           APA  CG    YG    P+F LD S  ++S P
Sbjct: 24  APATPCGGGGWYGEDEGPFFDLDLSCCSASAP 55


>05_01_0048 +
           331155-333077,333208-333354,333540-334087,334481-334616
          Length = 917

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = +3

Query: 231 HRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGD 344
           HR      E  EG  + +R+ S   +DV H+  H N D
Sbjct: 763 HRLLGNATEASEGSAQSHRITSPCKLDVPHRRAHSNSD 800


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,663,210
Number of Sequences: 37544
Number of extensions: 369035
Number of successful extensions: 1307
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1240
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1303
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -