SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0139 + 1105857-1107008,1107124-1107328,1107583-1107768,110...    30   2.1  
02_05_1261 + 35305909-35307042,35307779-35307968,35308550-35308818     29   3.7  
04_01_0609 + 7966263-7966366,7967945-7968706,7972607-7972851,797...    29   4.9  
07_03_0206 + 15177873-15177921,15178047-15178174,15178431-151785...    28   6.5  
06_03_0449 + 20907491-20910146,20910313-20910782                       28   6.5  

>08_01_0139 +
           1105857-1107008,1107124-1107328,1107583-1107768,
           1107924-1108133,1108552-1109186
          Length = 795

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = +2

Query: 605 HVPSGFGMSSPSRYFPSAMTCPSS--NEACG 691
           H P G G +S +R F +++ C SS  N+ CG
Sbjct: 189 HGPHGIGKTSAARIFAASLNCHSSGGNQPCG 219


>02_05_1261 + 35305909-35307042,35307779-35307968,35308550-35308818
          Length = 530

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = -1

Query: 254 GASAN-VVC--AGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLII 120
           G++AN +VC  A  +EQ+GY  +F +  + GFP     L+V  + L++
Sbjct: 482 GSAANLIVCEQARRSEQYGYTLSFFSHLQFGFP---ATLIVTGIGLLL 526


>04_01_0609 +
           7966263-7966366,7967945-7968706,7972607-7972851,
           7976940-7977107,7977471-7977734,7977962-7978509
          Length = 696

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 14/47 (29%), Positives = 30/47 (63%)
 Frame = +2

Query: 515 TSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFPS 655
           T++QQ+   ++++  +  +  T +V+ TF  +PSG+ +S+P R  P+
Sbjct: 148 TTTQQEEEHSMQVKVTVGMPVTQQVNMTF--LPSGYTLSAPYRLSPT 192


>07_03_0206 +
           15177873-15177921,15178047-15178174,15178431-15178521,
           15178836-15179311
          Length = 247

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -2

Query: 313 KH*SGIDLTGPSLPGNGTLMARAPTW 236
           KH + I   GPS+P N    A AP+W
Sbjct: 34  KHVAHIGWDGPSVPNNNNNTAGAPSW 59


>06_03_0449 + 20907491-20910146,20910313-20910782
          Length = 1041

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +1

Query: 616 RLWNELPFTVFSERYDMSFFKRGLWRYLGSGLVLP 720
           RL  E+P T+    YD SF    L    GSG  LP
Sbjct: 592 RLTGEVPLTLQGAAYDRSFLGNSLCARPGSGTNLP 626


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,969,774
Number of Sequences: 37544
Number of extensions: 507291
Number of successful extensions: 1048
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1015
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1048
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1886372480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -