SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0546 - 9381989-9383733,9385838-9386054                          158   4e-39
05_05_0109 - 22454539-22456268,22457069-22457279                      156   1e-38
11_08_0075 + 28173220-28173433,28175348-28177083                      156   2e-38
03_02_0540 + 9340379-9340592,9341250-9342988                          156   2e-38
03_06_0484 + 34233042-34233258,34235317-34237049                      155   3e-38
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    153   1e-37
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   125   4e-29
12_02_0825 + 23476943-23476952,23477263-23477328,23477737-234778...   124   5e-29
05_04_0392 - 20889699-20891726                                        124   9e-29
08_01_0654 - 5639419-5641449                                          122   3e-28
11_01_0564 - 4447078-4448519,4449465-4449711                          120   2e-27
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...   118   5e-27
03_02_0542 - 9348126-9349585,9352433-9352655                          117   8e-27
05_04_0052 - 17515344-17517353                                        116   1e-26
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836          111   7e-25
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819    110   1e-24
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...   109   2e-24
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...   103   2e-22
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...   101   8e-22
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...    99   3e-21
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165     95   7e-20
02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728...    75   4e-14
05_01_0550 + 4820086-4821255,4822112-4822321,4822429-4822524,482...    69   3e-12
12_01_0346 + 2652181-2653566                                           67   2e-11
01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425...    66   3e-11
06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    66   3e-11
06_03_1137 + 27903012-27904196,27904330-27904542,27905775-279058...    63   2e-10
05_07_0320 + 29235266-29235305,29235409-29236682                       60   2e-09
03_02_0180 - 6211823-6213559                                           51   1e-06
06_03_0067 - 16167420-16167845,16168291-16168406,16168634-161688...    36   0.032
02_05_0045 - 25393185-25394431,25394837-25395166,25395450-25396386     33   0.30 
12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231           32   0.52 
04_04_1012 - 30104401-30104955,30105066-30106841                       31   1.2  
04_04_1005 - 30043698-30044252,30044363-30046138                       31   1.2  
01_01_0633 - 4767914-4768020,4768057-4768085,4768590-4768745,476...    31   1.2  
08_01_0535 - 4638954-4639127,4639894-4639944,4640287-4640352,464...    30   1.6  
03_05_0224 - 22099472-22099813,22100496-22101032                       30   1.6  
06_01_0847 - 6451525-6451678,6452870-6453066,6454300-6454591,645...    30   2.1  
05_03_0458 + 14280953-14281866,14281964-14282912                       29   3.7  
01_01_1144 - 9066832-9066935,9067968-9068169,9068265-9068414,906...    29   3.7  
04_01_0206 + 2507827-2508705,2508844-2509902                           29   4.9  
02_04_0103 - 19768288-19768737                                         29   4.9  
09_03_0196 + 13374054-13374456,13375145-13375707,13375935-133759...    28   6.4  
03_05_0478 - 24712157-24712177,24712206-24712260,24712377-247124...    28   6.4  
02_01_0302 - 2021221-2023305                                           28   6.4  
01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602...    28   8.5  

>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  158 bits (384), Expect = 4e-39
 Identities = 73/81 (90%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVSILTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK+KKD
Sbjct: 200 KNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKD 259

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RALRRLRTACERAKRT
Sbjct: 260 ITGNPRALRRLRTACERAKRT 280



 Score =  153 bits (372), Expect = 1e-37
 Identities = 73/88 (82%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFY +ITRARFEELN DLFR  MEPVEK LRDAKMDKAQ
Sbjct: 278 KRTLSSTAQTTIEIDSLYEGIDFYATITRARFEELNMDLFRRCMEPVEKCLRDAKMDKAQ 337

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 338 IHDVVLVGGSTRIPKVQQLLQDFFNGKE 365



 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 34/68 (50%), Positives = 39/68 (57%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ ++ VQD           G+ETAGGVMT LI RNTTI
Sbjct: 368 KSINPDEAVAYGAAVQAAILSGEGNQRVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 427

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 428 PTKKEQVF 435


>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  156 bits (379), Expect = 1e-38
 Identities = 72/81 (88%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 198 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 257

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRTACERAKRT
Sbjct: 258 ISGNPRALRRLRTACERAKRT 278



 Score =  152 bits (369), Expect = 2e-37
 Identities = 71/88 (80%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFYT+ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 276 KRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSS 335

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 336 VHDVVLVGGSTRIPKVQQLLQDFFNGKE 363



 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 366 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 425

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 426 PTKKEQVF 433


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  156 bits (378), Expect = 2e-38
 Identities = 72/81 (88%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RALRRLRTACERAKRT
Sbjct: 259 ITGNPRALRRLRTACERAKRT 279



 Score =  149 bits (362), Expect = 2e-36
 Identities = 69/88 (78%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFY++ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 277 KRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSS 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIP+VQ+LLQDFFNGKE
Sbjct: 337 VHDVVLVGGSTRIPRVQQLLQDFFNGKE 364



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 34/68 (50%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           K+INPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 367 KNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQVF 434


>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  156 bits (378), Expect = 2e-38
 Identities = 72/81 (88%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RALRRLRTACERAKRT
Sbjct: 259 ITGNPRALRRLRTACERAKRT 279



 Score =  151 bits (365), Expect = 7e-37
 Identities = 70/88 (79%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFYT+ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 277 KRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIP+VQ+LLQDFFNGKE
Sbjct: 337 VHDVVLVGGSTRIPRVQQLLQDFFNGKE 364



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQVF 434


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  155 bits (377), Expect = 3e-38
 Identities = 70/81 (86%), Positives = 79/81 (97%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+VNHFVQEFKRK+KKD
Sbjct: 200 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKHKKD 259

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRT+CERAKRT
Sbjct: 260 ISGNPRALRRLRTSCERAKRT 280



 Score =  150 bits (363), Expect = 1e-36
 Identities = 69/88 (78%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSLFEG+DFY++ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 278 KRTLSSTAQTTIEIDSLFEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST 337

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIP+VQ+LLQDFFNGKE
Sbjct: 338 VHDVVLVGGSTRIPRVQQLLQDFFNGKE 365



 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 368 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 427

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 428 PTKKEQVF 435


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  153 bits (372), Expect = 1e-37
 Identities = 71/81 (87%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFV EFKRK KKD
Sbjct: 391 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVLEFKRKNKKD 450

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRTACERAKRT
Sbjct: 451 ISGNPRALRRLRTACERAKRT 471



 Score =  151 bits (365), Expect = 7e-37
 Identities = 70/88 (79%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFY++ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 469 KRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSS 528

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 529 VHDVVLVGGSTRIPKVQQLLQDFFNGKE 556



 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 559 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 618

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 619 PTKKEQVF 626


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  125 bits (301), Expect = 4e-29
 Identities = 58/89 (65%), Positives = 73/89 (82%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+  Q  +EI+SLF+G DF   +TRARFEELN DLFR TM PV+K++ DA ++K+Q
Sbjct: 300 KRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQ 359

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           IH+IVLVGGSTRIPKVQ+LL+D+F GKEP
Sbjct: 360 IHEIVLVGGSTRIPKVQQLLRDYFEGKEP 388



 Score =  120 bits (290), Expect = 9e-28
 Identities = 52/90 (57%), Positives = 70/90 (77%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L+FDLGGGTFDVSILTI++G+FEV +T GDTHLGGEDFD R++ +F++  K+KY
Sbjct: 219 GGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKY 278

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
            KD++ + RAL +LR   ERAKR     H+
Sbjct: 279 SKDISKDNRALGKLRREAERAKRALSNQHQ 308



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 32/72 (44%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK +NPDE           IL G+  +E +D           GIET GGVMT LI R
Sbjct: 386 KEPNKGVNPDEAVAYGAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPR 445

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 446 NTVIPTKKSQVF 457


>12_02_0825 +
           23476943-23476952,23477263-23477328,23477737-23477885,
           23478148-23478212,23479247-23479710,23479724-23480208
          Length = 412

 Score =  124 bits (300), Expect = 5e-29
 Identities = 63/88 (71%), Positives = 68/88 (77%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+G       AGDTHLGGEDFDNRMV HFVQEFKRK KKD
Sbjct: 229 KNVLIFDLGGGTFDVSLLTIEEG-------AGDTHLGGEDFDNRMVKHFVQEFKRKSKKD 281

Query: 191 LATNKRALRRLRTACERAKRTCHRPHKR 274
           +  N R + RLRTACE AKRT   P  R
Sbjct: 282 ITGNPRPVGRLRTACEWAKRTLSPPLPR 309



 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 48/78 (61%), Positives = 59/78 (75%)
 Frame = +1

Query: 274 SIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGS 453
           +IEIDSL+EGIDFY++IT ARFEEL  DLFR  M    +  +D +  +A     +LVGGS
Sbjct: 312 TIEIDSLYEGIDFYSNITCARFEELTMDLFRKCM----RGYQDGQ--RAACTMFILVGGS 365

Query: 454 TRIPKVQKLLQDFFNGKE 507
           TRIP+VQ+LLQDFFNGKE
Sbjct: 366 TRIPRVQQLLQDFFNGKE 383


>05_04_0392 - 20889699-20891726
          Length = 675

 Score =  124 bits (298), Expect = 9e-29
 Identities = 54/90 (60%), Positives = 71/90 (78%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVL+FDLGGGTFDVSIL I++G+FEV +T GDTHLGGEDFD R+++HFV+  +RK+
Sbjct: 231 GAEKNVLVFDLGGGTFDVSILAIDNGVFEVLATNGDTHLGGEDFDQRLMDHFVKVIRRKH 290

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
            +D+A + RAL +LR  CERAKR     H+
Sbjct: 291 GRDIAGDARALGKLRRECERAKRALSNQHQ 320



 Score =  117 bits (282), Expect = 8e-27
 Identities = 54/89 (60%), Positives = 69/89 (77%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+  Q  +EI+SLF+G+DF   ++RARFEELN DLF+ TM PV K++ DA + K  
Sbjct: 312 KRALSNQHQVRVEIESLFDGVDFSEPLSRARFEELNGDLFKKTMVPVRKAMADAGLGKGD 371

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL+D+F GKEP
Sbjct: 372 IDEIVLVGGSTRIPKVQQLLKDYFGGKEP 400



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 29/72 (40%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N+ +NPDE           I+ G   E  +            G+ETAGGVMT LI R
Sbjct: 398 KEPNRGVNPDEAVAYGAAVQASIISGHVDENTESMILLDVAPLTLGLETAGGVMTKLIPR 457

Query: 681 NTTIPTKQTQTF 716
           NT +PTK+TQ F
Sbjct: 458 NTVVPTKKTQVF 469


>08_01_0654 - 5639419-5641449
          Length = 676

 Score =  122 bits (294), Expect = 3e-28
 Identities = 53/90 (58%), Positives = 70/90 (77%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVL+FDLGGGTFDVSIL I++G+FEV +T GDTHLGGEDFD R+++HFV+  +RK+
Sbjct: 231 GAEKNVLVFDLGGGTFDVSILAIDNGVFEVLATNGDTHLGGEDFDQRLMDHFVKVIRRKH 290

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
            +D+  + RAL +LR  CERAKR     H+
Sbjct: 291 GRDITGDARALGKLRRECERAKRALSNQHQ 320



 Score =  117 bits (281), Expect = 1e-26
 Identities = 52/89 (58%), Positives = 70/89 (78%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+  Q  +E++SLF+G+D    ++RARFEELN+DLF+ TM PV K++ DA++ K  
Sbjct: 312 KRALSNQHQVRVEVESLFDGVDLSEPLSRARFEELNSDLFKKTMVPVRKAMADARLSKGD 371

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL+D+F GKEP
Sbjct: 372 IDEIVLVGGSTRIPKVQQLLKDYFGGKEP 400



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 28/72 (38%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N+ +NPDE           I+ G   E  +            G+ETAGGVM  LI R
Sbjct: 398 KEPNRGVNPDEAVAYGAAVQASIISGHVDENTESMILLDVAPLTLGLETAGGVMAKLIPR 457

Query: 681 NTTIPTKQTQTF 716
           NT +PTK+TQ F
Sbjct: 458 NTVVPTKKTQVF 469


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score =  120 bits (288), Expect = 2e-27
 Identities = 56/88 (63%), Positives = 70/88 (79%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IE+DSL +GIDF  ++TR+RFEELN DLF   ME +E  LRDAK+DK  
Sbjct: 295 KRMLSSTMQTTIEVDSLHQGIDFRVTLTRSRFEELNKDLFSKCMEAMENCLRDAKVDKWS 354

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + D+VLVGGSTRIPKVQK+L +FF+GKE
Sbjct: 355 VDDVVLVGGSTRIPKVQKMLSEFFDGKE 382



 Score =  115 bits (276), Expect = 4e-26
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 7/87 (8%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGI------FEVKSTAGDTHLGGEDFDNRMVNHFVQEFK 172
           R VL+FDLGGGTFD+S+L I+ G+      FEVK+TAGDTHLGG DFDN +V H ++EF 
Sbjct: 210 RMVLVFDLGGGTFDISLLNIDPGVNIDMGLFEVKATAGDTHLGGADFDNELVKHSLREFN 269

Query: 173 RKY-KKDLATNKRALRRLRTACERAKR 250
           RK+   D+ +N++ALRRLRTACERAKR
Sbjct: 270 RKHGSMDIESNQKALRRLRTACERAKR 296



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEE-VQDXXXXXXXXXXXG 638
           P+  +  + F   K   +SINPDE           IL G   ++ + D           G
Sbjct: 368 PKVQKMLSEFFDGKELCRSINPDEAVAYGAAIQASILCGGTDDKRLVDMLLREVTPLSLG 427

Query: 639 IETAGG-VMTTLIKRNTTIPTKQTQTF 716
           +ET     M+ +I RNT IPTK+ + F
Sbjct: 428 VETEDNCTMSVVIPRNTAIPTKKVKNF 454


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score =  118 bits (284), Expect = 5e-27
 Identities = 50/90 (55%), Positives = 71/90 (78%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G   NVL++DLGGGTFDVS+L+++ G+FEV +T+GDTHLGGEDFD R+++HF++  KR++
Sbjct: 225 GEMTNVLVYDLGGGTFDVSVLSLDHGVFEVLATSGDTHLGGEDFDRRVMDHFIRLVKRQH 284

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
            +D+  + RAL +LR  CERAKR   R H+
Sbjct: 285 GRDIGGDGRALGKLRRECERAKRALSRQHQ 314



 Score =  114 bits (274), Expect = 8e-26
 Identities = 52/89 (58%), Positives = 70/89 (78%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS   Q  +EI++LF G+DF  ++TRA+FEELN DLF+ T+ PV K++ DAK+ K+ 
Sbjct: 306 KRALSRQHQVRVEIEALFVGVDFSETLTRAKFEELNMDLFKKTLGPVRKAIADAKLKKSD 365

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL++ F+GKEP
Sbjct: 366 IDEIVLVGGSTRIPKVQELLKEMFDGKEP 394



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 31/72 (43%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K   K INPDE           I+ G+   E +D           GIETAGGVMT LI R
Sbjct: 392 KEPTKGINPDEAVAYGAAVQGSIISGEGGAETKDILLLDVTPLTLGIETAGGVMTKLIPR 451

Query: 681 NTTIPTKQTQTF 716
           NT IP K++Q F
Sbjct: 452 NTRIPVKKSQVF 463


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score =  117 bits (282), Expect = 8e-27
 Identities = 58/88 (65%), Positives = 71/88 (80%), Gaps = 7/88 (7%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDG------IFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           ++ VLIFDLGGGT DVS+L I+ G      IFEVK+TAGDTHLGGEDF+ RMV H V+EF
Sbjct: 202 KKRVLIFDLGGGTLDVSVLNIDPGVDIDIGIFEVKATAGDTHLGGEDFNGRMVKHLVREF 261

Query: 170 KRKYKK-DLATNKRALRRLRTACERAKR 250
            RKYK+ ++  ++RALRRLRTACE+AKR
Sbjct: 262 LRKYKRPEIRGDQRALRRLRTACEKAKR 289



 Score =  113 bits (271), Expect = 2e-25
 Identities = 53/89 (59%), Positives = 68/89 (76%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS+ Q +IEIDSL  G+DF+ ++TRA+FEELN DLF   M+ V++ LRDA  DK
Sbjct: 286 KAKRMLSSTAQTTIEIDSLHGGVDFHATVTRAKFEELNMDLFLECMDTVKQCLRDAGTDK 345

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
             + D+VLVGGSTRIPKV+ LLQD F+GK
Sbjct: 346 GTVDDVVLVGGSTRIPKVRSLLQDLFDGK 374



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSE-EVQDXXXXXXXXXXXGIETAGGVMTTLIK 677
           K   +SINPDE           +L+GD +E +++D           GIE  GG M+ LI 
Sbjct: 374 KALCRSINPDEAVAHGAAVKAALLNGDANEKDLRDVVLLDVTPLSLGIEVFGGGMSVLIP 433

Query: 678 RNTTIPTKQTQTF 716
           RNTTIP  + + +
Sbjct: 434 RNTTIPVSRQKMY 446


>05_04_0052 - 17515344-17517353
          Length = 669

 Score =  116 bits (280), Expect = 1e-26
 Identities = 51/87 (58%), Positives = 68/87 (78%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVL+FDLGGGTFDVS+L I+ G++EV +T GDTHLGGEDFD R++ HFV+  +RK+ +D
Sbjct: 230 KNVLVFDLGGGTFDVSVLAIDGGVYEVLATNGDTHLGGEDFDQRVMEHFVELVRRKHGRD 289

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +A + RAL +LR  CERAKR     H+
Sbjct: 290 IAGDARALGKLRRECERAKRALSIQHQ 316



 Score =  113 bits (271), Expect = 2e-25
 Identities = 51/89 (57%), Positives = 68/89 (76%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS   Q  +E++SLF+G+D    ++RARFEELN DLFR TM PV K++ DA++  A 
Sbjct: 308 KRALSIQHQVRVEVESLFDGVDLSEPLSRARFEELNNDLFRKTMAPVRKAMADARLSNAD 367

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKV++LL+D+F GK+P
Sbjct: 368 IDEIVLVGGSTRIPKVRQLLRDYFGGKQP 396



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 29/72 (40%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N+ +NPDE           I+ GD   + +D           G+ETAGGVM TLI R
Sbjct: 394 KQPNQGVNPDEAVAYGAAIQANIVGGDTDNKTRDMVVLDVTPLTLGLETAGGVMATLIPR 453

Query: 681 NTTIPTKQTQTF 716
           NT +PTK+ Q F
Sbjct: 454 NTPVPTKRAQLF 465


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score =  111 bits (266), Expect = 7e-25
 Identities = 51/88 (57%), Positives = 67/88 (76%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS + Q SIE+DSL +G+DF   ++R+RFEELN +LF   ++ VEK L DAKMDK+ 
Sbjct: 242 KRLLSFTAQTSIEVDSLHDGVDFCAKMSRSRFEELNKELFGKCVKAVEKCLEDAKMDKSA 301

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGS+RIPKVQ +L DFF  K+
Sbjct: 302 VHDVVLVGGSSRIPKVQSMLHDFFQEKK 329



 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 53/96 (55%), Positives = 65/96 (67%), Gaps = 16/96 (16%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTI-----------EDGIFE--VKSTAGDTHLGGEDFDNRMVN 151
           R VLIFDLGGGT DVS+L I           ++G FE  VK+ AGDTHLGG DFDN MV 
Sbjct: 148 RTVLIFDLGGGTLDVSLLNIARPGNNSSSNSDNGSFEFEVKAVAGDTHLGGADFDNAMVK 207

Query: 152 HFVQEFKRK---YKKDLATNKRALRRLRTACERAKR 250
           H + EF RK    +  + +N++A+RRLR+ACERAKR
Sbjct: 208 HCINEFIRKNDVAEDGVWSNQKAIRRLRSACERAKR 243



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 24/80 (30%), Positives = 30/80 (37%), Gaps = 8/80 (10%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAG-GV------ 659
           K    S+NPDE           IL+GD      D            I     GV      
Sbjct: 328 KKLRHSVNPDEAVAYGAAIQASILNGDSDNADADADDKKRVMILRDITPLSLGVEINFDH 387

Query: 660 -MTTLIKRNTTIPTKQTQTF 716
            M+ +I RNT IPTK T+ +
Sbjct: 388 TMSVVIPRNTFIPTKNTRRY 407


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score =  110 bits (264), Expect = 1e-24
 Identities = 49/81 (60%), Positives = 62/81 (76%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVL+FDLGGG   VS+L +  G   V++TAGD HLGGEDF+ RMV HFV +FK ++KKD
Sbjct: 198 KNVLVFDLGGGHTSVSLLAVASGKIAVRATAGDPHLGGEDFNGRMVEHFVAQFKAEHKKD 257

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RA+ RLR ACE+AKRT
Sbjct: 258 VGRNARAILRLRAACEQAKRT 278



 Score =  109 bits (262), Expect = 2e-24
 Identities = 47/90 (52%), Positives = 71/90 (78%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS++ A+IE++ L +G DFY++ITR +F+ELN DLF   ++P++K L  AKMD+
Sbjct: 274 QAKRTLSSASWAAIELERLHDGADFYSTITRDQFDELNLDLFCKCLDPIKKCLTGAKMDR 333

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + + D+V VGGSTRIP+V++L+QD F+GKE
Sbjct: 334 SSVDDVVFVGGSTRIPRVRRLIQDLFDGKE 363


>11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,
            4430555-4432052,4432199-4432217,4432469-4432675,
            4432814-4433065
          Length = 1363

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/109 (48%), Positives = 73/109 (66%)
 Frame = +1

Query: 181  QKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADL 360
            ++G R  Q++           K  LS + Q SIE+DSL +G+DF   ++R+RFEELN +L
Sbjct: 912  EEGIRSNQKAIRRLRSACERAKRLLSFTAQTSIEVDSLHDGVDFCAKMSRSRFEELNKEL 971

Query: 361  FRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            F   ++ VEK L DAKMDK  +HD+VLVGGS+RIPK+Q +L DFF  K+
Sbjct: 972  FGRCVKAVEKCLEDAKMDKGDVHDVVLVGGSSRIPKLQSMLHDFFQEKK 1020



 Score =  103 bits (248), Expect = 1e-22
 Identities = 49/88 (55%), Positives = 67/88 (76%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS +T ASIE+DSL +GIDF   ++R+RFEELN +LF   ++ V+K L DAKMDK  
Sbjct: 301 KRMLSFTTLASIEVDSLHDGIDFCGKMSRSRFEELNKELFGKCVKAVKKCLEDAKMDKNA 360

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + D+VLVGGS+RIPK+Q ++ DFF+ K+
Sbjct: 361 VDDVVLVGGSSRIPKLQSMIHDFFDEKK 388



 Score = 98.7 bits (235), Expect = 4e-21
 Identities = 54/96 (56%), Positives = 68/96 (70%), Gaps = 16/96 (16%)
 Frame = +2

Query: 11   RNVLIFDLGGGTFDVSILTI----------EDGI---FEVKSTAGDTHLGGEDFDNRMVN 151
            R VLIFDLGGGT DVS+L I          ++G    FEVK+ AGDTHLGG DFDN MVN
Sbjct: 839  RTVLIFDLGGGTLDVSLLNIGRPGNNSNSGDNGSSFEFEVKAVAGDTHLGGADFDNAMVN 898

Query: 152  HFVQEFKRKY---KKDLATNKRALRRLRTACERAKR 250
            H + EF RK+   ++ + +N++A+RRLR+ACERAKR
Sbjct: 899  HCINEFIRKHDVAEEGIRSNQKAIRRLRSACERAKR 934



 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 53/97 (54%), Positives = 66/97 (68%), Gaps = 14/97 (14%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTI---------EDGIFE--VKSTAGDTHLGGEDFDNRMV 148
           G  R VLIFDLGGGT DVS+L I         + G FE  VK+ AGDTHLGG DF+N +V
Sbjct: 206 GAGRMVLIFDLGGGTLDVSLLNIGRPGNNNSSDSGSFEFEVKAVAGDTHLGGADFNNAIV 265

Query: 149 NHFVQEFKRKY---KKDLATNKRALRRLRTACERAKR 250
            H + EF RK+    + + +N++A+RRLRTACERAKR
Sbjct: 266 KHCINEFIRKHGVAAEGIWSNQKAIRRLRTACERAKR 302



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 7/54 (12%)
 Frame = +2

Query: 17   VLIFDLGGGTFDVSILTIEDGI-------FEVKSTAGDTHLGGEDFDNRMVNHF 157
            VL+FDLGGGTFDVS+L I+ G+       FEVK+TAGDTHLGG DFDN +   F
Sbjct: 1231 VLVFDLGGGTFDVSLLNIDPGVNTDMGRLFEVKATAGDTHLGGADFDNDLFRLF 1284



 Score = 31.9 bits (69), Expect = 0.52
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 4/76 (5%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSE---EVQDXXXXXXXXXXXGIETA-GGVMTT 668
           K   +++NPDE           +L+GD  E   + Q            GIE      M+ 
Sbjct: 387 KKLRRNVNPDEAVAYGAAIQASVLNGDADEADDKKQVMILRDITPLSLGIEVGLDHTMSV 446

Query: 669 LIKRNTTIPTKQTQTF 716
           +I RNT IPTK  + +
Sbjct: 447 VIPRNTFIPTKNVRRY 462



 Score = 28.3 bits (60), Expect = 6.4
 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 6/78 (7%)
 Frame = +3

Query: 501  KGANKSINPDEXXXXXXXXXXXILHGDKSE---EVQDXXXXXXXXXXXGIETAGG---VM 662
            K    S+NPDE           IL+GD  +   + +            G+E        M
Sbjct: 1019 KKLRHSVNPDEAVAYGAAIQASILNGDADDADDKKKAMILRDITPFSLGVEIYDENDHTM 1078

Query: 663  TTLIKRNTTIPTKQTQTF 716
            + +I RNT IP K TQ +
Sbjct: 1079 SVVIPRNTFIPAKNTQRY 1096


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score =  103 bits (246), Expect = 2e-22
 Identities = 48/77 (62%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FDLGGGTFDVSIL I +G+FEVK+T GDT LGGEDFDN ++   V EFKR    DLA
Sbjct: 239 IAVFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDNTLLEFLVSEFKRSEAIDLA 298

Query: 197 TNKRALRRLRTACERAK 247
            ++ AL+RLR A E+AK
Sbjct: 299 KDRLALQRLREAAEKAK 315



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS+ Q  I +  +            ++TR++FE L   L   T EP +  L+DA
Sbjct: 313 KAKIELSSTAQTEINLPFITADASGAKHLNITLTRSKFESLVNSLIERTREPCKNCLKDA 372

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +   ++ +++LVGG TR+PKVQ+++ + F GK P
Sbjct: 373 GITTKEVDEVLLVGGMTRVPKVQEIVSEIF-GKSP 406



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K +NPDE           IL GD    V++           GIET GG+ T LI R
Sbjct: 404 KSPSKGVNPDEAVAMGAAIQGGILRGD----VKELLLLDVTPLSLGIETLGGIFTRLINR 459

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 460 NTTIPTKKSQVF 471


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score =  101 bits (241), Expect = 8e-22
 Identities = 47/77 (61%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FDLGGGTFDVSIL I +G+FEVK+T GDT LGGEDFDN ++   V EFKR    DL+
Sbjct: 219 IAVFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDNTLLEFLVSEFKRTEGIDLS 278

Query: 197 TNKRALRRLRTACERAK 247
            ++ AL+RLR A E+AK
Sbjct: 279 KDRLALQRLREAAEKAK 295



 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS+ Q  I +  +            ++TR++FE L   L   T +P +  L+DA
Sbjct: 293 KAKIELSSTAQTEINLPFITADSSGAKHLNITLTRSKFESLVNSLIERTRDPCKSCLKDA 352

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +    + +++LVGG TR+PKVQ+++ + F GK P
Sbjct: 353 GITTKDVDEVLLVGGMTRVPKVQEVVSEIF-GKAP 386



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K +NPDE           IL GD    V+D           GIET GG+ T LI R
Sbjct: 384 KAPSKGVNPDEAVAMGAAIQGGILRGD----VKDLLLLDVTPLSLGIETLGGIFTRLINR 439

Query: 681 NTTIPTKQTQTF 716
           NTT+PTK++Q F
Sbjct: 440 NTTVPTKKSQVF 451


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 58/77 (75%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L+FDLGGGTFDVS+L + DG+FEV ST+GDTHLGG+DFD R+V+     FK     DL 
Sbjct: 171 ILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAGNFKNDEGIDLL 230

Query: 197 TNKRALRRLRTACERAK 247
            +K+AL+RL  A E+AK
Sbjct: 231 KDKQALQRLTEAAEKAK 247



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS TQ +I +  +    D      T++TRA+FEEL +DL      PV+ +LRDA
Sbjct: 245 KAKMELSSLTQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVDNALRDA 304

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           K+    I +++LVGGSTRIP VQ L++    GK+P
Sbjct: 305 KLSFKDIDEVILVGGSTRIPAVQDLVKK-MTGKDP 338



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 27/72 (37%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N ++NPDE           +L GD    V D           G+ET GGVMT +I R
Sbjct: 336 KDPNVTVNPDEVVALGAAVQAGVLSGD----VSDIVLLDVTPLSLGLETLGGVMTKIIPR 391

Query: 681 NTTIPTKQTQTF 716
           NTT+PT +++ F
Sbjct: 392 NTTLPTSKSEVF 403


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 42/81 (51%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query: 268 QASIEIDSLFEG-IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLV 444
           Q  +EI++L +G +D   ++TRA+FEELN DLF  TM P+ K++ DA ++K  I++I+ V
Sbjct: 303 QVRVEIEALLDGGVDLSETLTRAQFEELNDDLFARTMAPLRKTMADAGLEKGDINEIIHV 362

Query: 445 GGSTRIPKVQKLLQDFFNGKE 507
           GGSTRIPKVQ+L++D+F+GK+
Sbjct: 363 GGSTRIPKVQQLIRDYFDGKK 383



 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 38/80 (47%), Positives = 53/80 (66%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++FDLGG   DV+ L  +DG F+V +T GD +LGGE FD R+VNHFV   KRK+ +D
Sbjct: 226 KRVVVFDLGGENLDVTALVADDGFFDVLATNGDGYLGGEGFDQRVVNHFVDLIKRKHGRD 285

Query: 191 LATNKRALRRLRTACERAKR 250
           +  + RA+ RLR   +   R
Sbjct: 286 ITGDGRAMHRLRRDAQHQVR 305



 Score = 31.1 bits (67), Expect = 0.91
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +3

Query: 639 IETAGGVMTTLIKRNTTIPTKQTQTF 716
           IETAGG +T +I R + +P ++T  F
Sbjct: 432 IETAGGAVTPMIPRRSRLPAERTHVF 457


>02_05_0491 +
           29470575-29471351,29471574-29471806,29472697-29472856,
           29473149-29473394,29473492-29473628,29473874-29474207,
           29474283-29474444,29474717-29474791,29474866-29474966,
           29475042-29475111,29475210-29475266,29475357-29475418,
           29475505-29475577,29475663-29475884
          Length = 902

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 35/83 (42%), Positives = 57/83 (68%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++T A I ++SL+  +DF ++ITR +FEEL  +L+   + PV++ L  + M    
Sbjct: 314 KEILSANTAAPISVESLYNDLDFRSTITREKFEELCEELWEQALTPVKEVLAHSGMKIDD 373

Query: 424 IHDIVLVGGSTRIPKVQKLLQDF 492
           I+ + L+GG+TR+PK+Q  LQ+F
Sbjct: 374 IYAVELIGGATRVPKLQAKLQEF 396



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/93 (24%), Positives = 48/93 (51%), Gaps = 14/93 (15%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSIL------------TIEDGIFEVKSTAGDTHLGGEDFDNRMVNH 154
           R+V+ +D+G G+   +++            T+    F+VK    D+ LGG + + R+VN+
Sbjct: 222 RHVIFYDMGAGSTYAALVYYSAYKAKEFGKTVSVNQFQVKDVRWDSKLGGLEMEMRLVNY 281

Query: 155 FVQEFKRKYKK--DLATNKRALRRLRTACERAK 247
           F  +F ++     D+  + +A+ +L+   +R K
Sbjct: 282 FADQFNKQLGNGVDIRQSPKAMAKLKKQVKRTK 314


>05_01_0550 +
           4820086-4821255,4822112-4822321,4822429-4822524,
           4822610-4822828,4823201-4823395,4823466-4823612,
           4823712-4823861,4825015-4825145,4825234-4825477
          Length = 853

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  VSI+  + G   + S A D  LGG DFD  +  HF ++FK +YK D+
Sbjct: 195 NVAFIDVGHASMQVSIVGYKKGQLNMLSHAYDRSLGGRDFDEVLFKHFAEKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
             N RA  RLR ACE+ K+
Sbjct: 255 YQNARACVRLRVACEKLKK 273



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 27/89 (30%), Positives = 54/89 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +A + I+ L +  D    I R  FE++++ + +    P+EK+L +A +    
Sbjct: 272 KKMLSANPEAPLNIECLMDEKDVRGFIKREEFEQISSPVLQRVKAPLEKALAEAGLTTEN 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + +VG  +R+P + +++ +FF GKEP
Sbjct: 332 VHFVEVVGSGSRVPAIIRIITEFF-GKEP 359


>12_01_0346 + 2652181-2653566
          Length = 461

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 38/94 (40%), Positives = 60/94 (63%), Gaps = 6/94 (6%)
 Frame = +1

Query: 244 KEDLSSS--TQASIEIDSLFEG-IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           K  LSS    Q ++   +L  G   F  S+TRA+FEELN DLF   +  V+ ++ +A+  
Sbjct: 308 KRTLSSHDVAQVNLHATNLANGAFSFSGSLTRAQFEELNHDLFEKVISLVDAAMAEARRA 367

Query: 415 KAQ---IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            A    I ++VLVGGST+IP++++L++++F GKE
Sbjct: 368 VAGFDVIDEVVLVGGSTKIPRIRELIKNYFAGKE 401



 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 32/80 (40%), Positives = 48/80 (60%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL+  +GGGT   ++LT ++ +FE  ++  D HLGG+DFD R+   F Q  KR +    
Sbjct: 233 NVLVLHVGGGTSAATVLTYDNAVFEAVASRHDAHLGGDDFDARIAGRFSQLIKRDHGG-- 290

Query: 194 ATNKRALRRLRTACERAKRT 253
             +  A  +L++ CE AKRT
Sbjct: 291 GVDDIAPAKLKSQCELAKRT 310


>01_01_0573 +
           4253484-4254653,4255526-4255735,4255842-4255937,
           4256034-4256255,4256829-4257023,4257097-4257243,
           4257323-4257472,4257762-4257892,4257978-4258194
          Length = 845

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 33/79 (41%), Positives = 44/79 (55%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  V I   + G  ++ S A D  LGG DFD  +  HF  +FK +YK D+
Sbjct: 195 NVAFVDVGHASMQVCIAGYKKGQLKILSHAYDRSLGGRDFDEVLFKHFAAKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
             N RA  RLR ACE+ K+
Sbjct: 255 YQNARACIRLRVACEKLKK 273



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 30/89 (33%), Positives = 53/89 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ ++ + I+ L +  D    I R  FE+++A +      P+EK+L +A +    
Sbjct: 272 KKVLSANPESPMHIECLMDEKDVRGFIKREEFEKISASILERVKGPLEKALAEAGLTTEN 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + +VG  +R+P + K+L DFF GKEP
Sbjct: 332 VHFVEVVGSGSRVPAIIKILTDFF-GKEP 359


>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 36/113 (31%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = +1

Query: 166 VQEEIQKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFE-GIDFYTSITRARFE 342
           ++E+  +  R ++++           K+ LS   +  +++DSL + G  F  ++TRA+FE
Sbjct: 343 IKEQHGRDVRQEEKAMVRLRVACEHAKKALSEQQETLVQMDSLLDDGAVFSATLTRAKFE 402

Query: 343 ELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ELN DL    M  V++ +      +  + ++++VGGS RIPKV++L++D+FNG
Sbjct: 403 ELNHDLLDRAMALVKEVVVTTGGVEV-VDEVLVVGGSARIPKVRQLVKDYFNG 454



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 13/96 (13%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGG-------------EDFDNR 142
           G R+ +L+F LGG T   +I    DG   + +T     LGG             +DF  R
Sbjct: 275 GDRKAILVFHLGGRTSHATIFKFVDGTARLIATRAHHFLGGKIDQCPASFLNTSDDFTAR 334

Query: 143 MVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKR 250
           +V+H V+  K ++ +D+   ++A+ RLR ACE AK+
Sbjct: 335 IVDHMVEHIKEQHGRDVRQEEKAMVRLRVACEHAKK 370


>06_03_1137 +
           27903012-27904196,27904330-27904542,27905775-27905867,
           27905940-27906008,27906412-27906612,27906688-27906834,
           27907524-27907652,27909001-27909131,27909240-27909333
          Length = 753

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V   D+G     V+++  +    +V S   D  LGG DFD  +  HF +EF+ KYK D+ 
Sbjct: 201 VAFVDVGHCDTQVAVVAFDVSGMKVLSHRFDADLGGRDFDEVLFEHFAEEFRDKYKIDVT 260

Query: 197 TNKRALRRLRTACERAKR 250
            N +A  RLR ACE+AK+
Sbjct: 261 GNVKASMRLRAACEKAKK 278



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 29/91 (31%), Positives = 53/91 (58%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K+ LS++ +A + I+ L E  D    I R  FE+L A L    +EP +K++  +++  
Sbjct: 275 KAKKVLSANAEAVVNIECLMEEKDVRGMIRREEFEKLCAGLLERVVEPCKKAMEGSRIGF 334

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            ++H + LVG  +R+P + ++L  FF  +EP
Sbjct: 335 DRLHSVELVGSGSRVPAIARILAGFFR-REP 364


>05_07_0320 + 29235266-29235305,29235409-29236682
          Length = 437

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  + +L+F LGG T   +   I DG   + +   D  LGG+DF  R+V+H     K K+
Sbjct: 230 GDGKVILVFHLGGRTAHATKFVIRDGTPSLIALRHDPFLGGDDFTARVVDHMADLIKDKH 289

Query: 182 -KKDLATNKRALRRLRTACERAKR 250
             +D+  +  ALRRL   CERAK+
Sbjct: 290 GGRDVRADAAALRRLTAECERAKK 313



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/66 (43%), Positives = 43/66 (65%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F   +TR++ EEL  DL    ++ VE S   +  D   + +I+LVGGSTRIP V+ L++D
Sbjct: 334 FSEPLTRSKLEELIGDLVGRAVDLVE-SCDASGGDVVGVDEILLVGGSTRIPMVRDLVKD 392

Query: 490 FFNGKE 507
           +F+GKE
Sbjct: 393 YFHGKE 398


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 STQASIEID-SLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIV 438
           +TQ  +EI+  L  G      + R  FE++N  +F      +++ L DAK+    I+D++
Sbjct: 312 ATQEHVEINVDLGAGHKVSKILDRGEFEKVNQSIFEKCEGIIKQCLADAKLTPEDINDVI 371

Query: 439 LVGGSTRIPKVQKLL 483
           LVGG +RIPK++ ++
Sbjct: 372 LVGGCSRIPKIRSVV 386



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/81 (25%), Positives = 41/81 (50%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +  LIF++G G  D ++     G+ ++++ +G T +GGED    ++ H + +F   Y
Sbjct: 228 GIEKIALIFNMGAGYCDAAVAATAGGVSQIRALSGST-VGGEDILQNVMRHLMPDFDSLY 286

Query: 182 KKDLATNKRALRRLRTACERA 244
                   +++  LR A + A
Sbjct: 287 AGQTMDRIKSIGLLRMATQDA 307


>06_03_0067 -
           16167420-16167845,16168291-16168406,16168634-16168871,
           16168903-16169033,16169100-16169289
          Length = 366

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = -1

Query: 175 PLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDK 20
           PL+ LD++V  A+V+VL ++         LE  ++DG D  VE  AAEV+D+
Sbjct: 88  PLDELDEMVHDALVEVLAAE--------DLEHAVVDGYDADVERVAAEVEDE 131


>02_05_0045 - 25393185-25394431,25394837-25395166,25395450-25396386
          Length = 837

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGED 130
           R N+ +F+     ++V+ ++IE+G   V +   DT  GGED
Sbjct: 312 RGNITLFNPRDARYNVTDVSIEEGTMVVSNLLNDTEYGGED 352


>12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231
          Length = 270

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 12/14 (85%), Positives = 14/14 (100%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVS 58
           +L+FDLGGGTFDVS
Sbjct: 238 ILVFDLGGGTFDVS 251


>04_04_1012 - 30104401-30104955,30105066-30106841
          Length = 776

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -2

Query: 129 SSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           S PP+  SPA+     +P+  + +D    PPP S ++T
Sbjct: 578 SPPPRVTSPALAQGPVVPTGAMEIDDIVAPPPPSPVAT 615


>04_04_1005 - 30043698-30044252,30044363-30046138
          Length = 776

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -2

Query: 129 SSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           S PP+  SPA+     +P+  + +D    PPP S ++T
Sbjct: 578 SPPPRVTSPALAQGPVVPTGAMEIDDIVAPPPPSPVAT 615


>01_01_0633 -
           4767914-4768020,4768057-4768085,4768590-4768745,
           4768835-4768983,4769106-4769638,4769900-4770068,
           4770255-4770347,4770641-4770698,4771392-4771471,
           4771548-4771715,4772090-4772242,4772756-4772884,
           4772996-4773085,4773990-4774129,4774683-4774814,
           4774916-4775087
          Length = 785

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +2

Query: 29  DLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNK 205
           D+ G  F   + T+E GI  + S AG T  G  D D  +V H     K+K  K L ++K
Sbjct: 439 DVSGSFFVYQMSTLEAGI-PLSSYAGKTWNGNIDMDGLIVVHGRVRIKKKPWKGLNSSK 496


>08_01_0535 -
           4638954-4639127,4639894-4639944,4640287-4640352,
           4640492-4640557,4640701-4640892,4641282-4641780,
           4642009-4642364
          Length = 467

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/61 (32%), Positives = 26/61 (42%)
 Frame = -1

Query: 235 TCSTQTPKSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDG 56
           T S+++P S   GS + F  P      V D A + V    V   GGG   +   LDG   
Sbjct: 68  TASSESPGSLATGSSITFQEPA---GGVADPAAIAVHAQTVAGGGGGGWNQQPFLDGSGF 124

Query: 55  H 53
           H
Sbjct: 125 H 125


>03_05_0224 - 22099472-22099813,22100496-22101032
          Length = 292

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 5/55 (9%)
 Frame = +3

Query: 336 LRGAERRSVQVYHGASG-----EVSP*CQDG*GSNPRYCTGGWLHSYPQGAEAPA 485
           +R   +R    YH AS       V+     G G     C GGW HSY  GA A A
Sbjct: 27  VRKRVQRVAAAYHAASKLPPPPAVATKASLGGGCADAPCAGGWCHSYGDGAAAAA 81


>06_01_0847 -
           6451525-6451678,6452870-6453066,6454300-6454591,
           6454622-6454654,6454869-6455102,6455204-6455259,
           6455552-6456754
          Length = 722

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 13/48 (27%), Positives = 28/48 (58%)
 Frame = +1

Query: 334 RFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           ++ E+N D+F S    +E +   + + K   +D+ L+GG T + K+++
Sbjct: 269 KYVEINIDIFPSRKMELENNTGSSTVPKVYFNDL-LIGGLTELKKMEE 315


>05_03_0458 + 14280953-14281866,14281964-14282912
          Length = 620

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 24  SLTSAAVPSTCPSLPSRMVSSR*NPPPATPT 116
           SLT+ + PS+ PS P  +   +  PPP  PT
Sbjct: 51  SLTTTSSPSSSPSSPPPLPPLQPTPPPLPPT 81


>01_01_1144 -
           9066832-9066935,9067968-9068169,9068265-9068414,
           9068553-9068637,9069264-9069343,9069972-9070070
          Length = 239

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = -2

Query: 507 LLSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGR 367
           LLS+ EI   LL LGD S    Q N++D  L    ++  L+    GR
Sbjct: 107 LLSLAEINDSLLELGDKSVEPLQINVLDYVLGVADLSGELMRLAIGR 153


>04_01_0206 + 2507827-2508705,2508844-2509902
          Length = 645

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +2

Query: 293 SLRVLTSTRQLL-VLASRS*TPICSGLPWSQWRSLSVMPR-WIRLKSTIL 436
           S+RVL+ T  L+  LAS        G+PWS   +++   R W RL+ ++L
Sbjct: 287 SIRVLSPTTSLINALASSWALGFLYGMPWSWLENMAFHVRWWHRLRRSVL 336


>02_04_0103 - 19768288-19768737
          Length = 149

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 21/63 (33%), Positives = 25/63 (39%), Gaps = 1/63 (1%)
 Frame = +3

Query: 24  SLTSAAVPSTCP-SLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLP 200
           S T+  V +  P S  SR      +PPP  PTW  R    A +T      RG       P
Sbjct: 40  SATAVIVIAAAPRSRMSRCRRREPSPPPLPPTWHAREDVAAAATWEPSPPRGGRGWIDGP 99

Query: 201 TRE 209
            RE
Sbjct: 100 MRE 102


>09_03_0196 +
           13374054-13374456,13375145-13375707,13375935-13375976,
           13376059-13376087,13376309-13376534,13376970-13377008,
           13377126-13377155
          Length = 443

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = +2

Query: 236 ERAKRTCHRPHKRALR*ILSLRVLTSTRQLLVLASRS*TPICSGLPWSQWRSLSVMPRWI 415
           +R K     P  +A +    +   TS   LLV+  R        LPW  W  L ++P+W 
Sbjct: 306 KRGKAATSMPESKAGKVDPEVGHRTSKMLLLVVLDRE------SLPWRHWILLVIVPKWS 359

Query: 416 RL 421
           R+
Sbjct: 360 RV 361


>03_05_0478 -
           24712157-24712177,24712206-24712260,24712377-24712473,
           24712558-24713302,24713822-24714189,24714279-24714419,
           24715480-24715849
          Length = 598

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -1

Query: 241 PLTCSTQTPKSSLVGSEVLFVFP-LELLDKV-VDHAIVKVLTSQVGVAGGGFHLEDTILD 68
           PLT S    K+SL      F+   + + DKV V HAI KV  + V +  G   + + ILD
Sbjct: 372 PLTLSESEAKASLQSDIDRFINEKIVVADKVIVSHAITKVRDNDVLLTYGSSSVVEMILD 431


>02_01_0302 - 2021221-2023305
          Length = 694

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = -2

Query: 135 SKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPPRS 28
           S  + P + SP V +T   P+S  R D    PPP S
Sbjct: 536 STPTHPSYPSPPVTYTPPPPTSADRPDVRFAPPPGS 571


>01_06_0668 +
           31058497-31059510,31059609-31059676,31060189-31060270,
           31060339-31060431,31060516-31060668,31060900-31060968,
           31061091-31061184,31061594-31061677,31062133-31062221,
           31062340-31062456,31062567-31062707,31062823-31063005
          Length = 728

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 4/75 (5%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEP--VEKSLRDAKM 411
           E +  L+S T A + +DS   G  FY S T  + +EL  +  +    P    +SL D  M
Sbjct: 428 ENRAMLTSRTVAYLNVDSAVYGAGFYASAT-PQLDELLKEASKQVQNPDNETQSLYDLWM 486

Query: 412 --DKAQIHDIVLVGG 450
             D + +  I  +GG
Sbjct: 487 ASDSSSMIKIGRIGG 501


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,463,786
Number of Sequences: 37544
Number of extensions: 478739
Number of successful extensions: 1721
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 1579
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1697
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1862792824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -