SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1250 - 25183375-25183815                                         88   3e-18
03_04_0027 + 16593133-16593573                                         87   5e-18
02_01_0563 + 4134954-4135388                                           87   5e-18
11_03_0135 - 10547460-10547558,10547926-10548086,10548183-105483...    28   4.7  
09_04_0302 + 16501020-16501049,16501568-16501659,16502063-165021...    27   6.2  
08_02_1146 + 24678142-24678258,24678550-24678587,24678997-246790...    27   6.2  
02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486     27   6.2  
04_03_1020 - 21761297-21761555,21761630-21761739,21762402-217626...    27   8.2  
03_05_0070 - 20478396-20478505,20478605-20478780,20481162-204812...    27   8.2  

>07_03_1250 - 25183375-25183815
          Length = 146

 Score = 88.2 bits (209), Expect = 3e-18
 Identities = 40/78 (51%), Positives = 48/78 (61%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M TS +K RK RGHVS                 NAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MTTSLRKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH  +NK + P +N+++L
Sbjct: 61  FHRLRNKFYSPAVNVERL 78


>03_04_0027 + 16593133-16593573
          Length = 146

 Score = 87.4 bits (207), Expect = 5e-18
 Identities = 40/78 (51%), Positives = 46/78 (58%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T  KK RK RGHVS                 NAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH   N+  CP +N+++L
Sbjct: 61  FHKLSNRFHCPAVNVERL 78


>02_01_0563 + 4134954-4135388
          Length = 144

 Score = 87.4 bits (207), Expect = 5e-18
 Identities = 40/78 (51%), Positives = 46/78 (58%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T  KK RK RGHVS                 NAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH   N+  CP +N+++L
Sbjct: 61  FHRLSNRFHCPAVNVERL 78


>11_03_0135 -
           10547460-10547558,10547926-10548086,10548183-10548306,
           10548566-10548729,10549803-10549883,10549973-10550097,
           10550200-10550430,10550566-10550588,10551055-10551539,
           10551678-10552075,10552903-10552988,10553120-10553397,
           10553494-10553714,10553927-10554018,10554148-10554213,
           10555855-10556022
          Length = 933

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +2

Query: 278 EAEVCICSRWQ-GPRHQYCQSWILQVARQRQTPQTTCHSK 394
           E ++ +CSR   G  H YC   ++Q   + +    TCHS+
Sbjct: 288 EEKLAVCSRCNDGAEHIYCMRVMMQEVPKAKWLCETCHSE 327


>09_04_0302 +
           16501020-16501049,16501568-16501659,16502063-16502198,
           16502297-16502727,16502950-16503028
          Length = 255

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = -1

Query: 148 FCDGAHHQHYHDLLDAYG 95
           +C+G HH H H   D+ G
Sbjct: 132 YCNGGHHHHGHQCYDSVG 149


>08_02_1146 +
           24678142-24678258,24678550-24678587,24678997-24679012,
           24679874-24680002,24680073-24680229,24680337-24680530,
           24680668-24680916,24681196-24681309,24681949-24681990,
           24682402-24682572,24682932-24683104,24683378-24683624,
           24684046-24684130,24684401-24684510,24684714-24684977,
           24685885-24685950,24686431-24686525,24686780-24686858
          Length = 781

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 9/27 (33%), Positives = 12/27 (44%)
 Frame = +2

Query: 311 GPRHQYCQSWILQVARQRQTPQTTCHS 391
           GP H     WI +  +Q   P+   HS
Sbjct: 258 GPMHNAADKWITEFGKQNNNPEEWAHS 284


>02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486
          Length = 296

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = -3

Query: 131 PPALPRPPGCLRCFPIRPCP 72
           PPA P PP  L C P+ P P
Sbjct: 10  PPAPPSPPPALPCDPMPPPP 29


>04_03_1020 -
           21761297-21761555,21761630-21761739,21762402-21762635,
           21762710-21762817,21762910-21762969,21763549-21763624,
           21763710-21763870,21764485-21764547,21764657-21764744,
           21765062-21765592,21766344-21766783
          Length = 709

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%)
 Frame = -3

Query: 134 SPP-ALPRPPGCLRCFPIRPCP 72
           SPP  LP PPG   C P+ P P
Sbjct: 263 SPPHPLPLPPGPATCSPLPPSP 284


>03_05_0070 -
           20478396-20478505,20478605-20478780,20481162-20481265,
           20481346-20481504,20481718-20481857,20482222-20482311,
           20482902-20482970,20484295-20484516,20486175-20486293,
           20486377-20486492,20488058-20488146,20488790-20488883
          Length = 495

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = +2

Query: 320 HQYCQSWILQVARQRQTPQTTCHSKSKVLLKISREENQGCGWC 448
           H Y  S ILQ   QR +      +   V + I    N+G  WC
Sbjct: 437 HTYLDSAILQHQLQRLSEHNLLKATPSVFVVIQAIVNEGAVWC 479


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,881,083
Number of Sequences: 37544
Number of extensions: 257611
Number of successful extensions: 768
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 747
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 767
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1023611560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -