SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0519 - 19945456-19945653,19947110-19947112                       52   6e-07
11_06_0495 - 24319531-24320831,24320923-24321109,24322919-243230...    46   3e-05

>12_02_0519 - 19945456-19945653,19947110-19947112
          Length = 66

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 243
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPMVLGFFIFVVIGS 53


>11_06_0495 -
           24319531-24320831,24320923-24321109,24322919-24323062,
           24324467-24324469
          Length = 544

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFV 231
           KNIT RG+VP+TT +K + YPV P +L  FIFV
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFV 49


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,752,884
Number of Sequences: 37544
Number of extensions: 360045
Number of successful extensions: 707
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 684
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 707
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1768474200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -