SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_1199 - 9657169-9657254,9657369-9657395,9657485-9657553,965...    54   1e-07
05_05_0300 + 23932947-23933196,23934022-23934123,23934249-239343...    51   9e-07
01_06_1103 - 34543915-34543955,34544069-34544137,34544294-345443...    45   6e-05
04_04_0008 + 22125707-22125828,22127122-22127197,22127297-221273...    30   2.3  
10_08_0435 + 17905728-17905901,17906608-17906931,17907205-179073...    28   9.4  
08_02_0856 - 21928499-21929626,21929728-21929788,21929950-21930899     28   9.4  
02_04_0358 - 22346745-22346804,22347268-22347273,22347439-223475...    28   9.4  

>01_01_1199 -
           9657169-9657254,9657369-9657395,9657485-9657553,
           9657922-9658023,9659895-9660000,9660145-9660165
          Length = 136

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/42 (59%), Positives = 32/42 (76%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK+ ++IN++L LVMKSGKY LGYK  L+    +K
Sbjct: 1   MVAAKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSK 42



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/32 (56%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +    TLR  KAKLVII+ N PPLR
Sbjct: 25  GKYTLGYKTVLRTLRNSKAKLVIISNNCPPLR 56


>05_05_0300 +
           23932947-23933196,23934022-23934123,23934249-23934317,
           23934406-23934446
          Length = 153

 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 26/56 (46%), Positives = 36/56 (64%)
 Frame = +3

Query: 108 HCFILGFISIYASKMVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           H F+  F+ + +   V A  QKK+ ++IN++L LVMKSGKY LGYK  LK    +K
Sbjct: 29  HHFVAMFLLV-SDWWVVAMMQKKSTDNINNKLQLVMKSGKYTLGYKTVLKTLRNSK 83



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLR  K KL+I+A N PPLR
Sbjct: 66  GKYTLGYKTVLKTLRNSKGKLIILANNCPPLR 97


>01_06_1103 -
           34543915-34543955,34544069-34544137,34544294-34544395,
           34545603-34545708,34545998-34546079,34546850-34547142
          Length = 230

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 21/35 (60%), Positives = 24/35 (68%)
 Frame = +3

Query: 171 KKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           KK  E IN++L LVMKSGKY LGYK  LK    +K
Sbjct: 126 KKNAEGINNKLQLVMKSGKYTLGYKTVLKTLRNSK 160



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  +   +TLR  K KLVI+A N PPLR
Sbjct: 143 GKYTLGYKTVLKTLRNSKGKLVIVANNCPPLR 174


>04_04_0008 +
           22125707-22125828,22127122-22127197,22127297-22127367,
           22127502-22127995,22128079-22128239,22128329-22128532,
           22129292-22129526,22129996-22130591
          Length = 652

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = +1

Query: 565 LNTVLLDHNVGNLWSSL*--TRYCTLAGKNYVFYSN 666
           L T+L  +    +W SL    + C L+GK+Y++YS+
Sbjct: 306 LRTILGSNMSNKMWESLVEHAKTCVLSGKHYIYYSS 341


>10_08_0435 +
           17905728-17905901,17906608-17906931,17907205-17907321,
           17908418-17908597,17909064-17909190,17909327-17909440,
           17909794-17909909
          Length = 383

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +3

Query: 192 NSRLALVMKSGKYCLGYKQTLKLFDKAKQSWLSSLKMLLR*GEATEK 332
           ++R    +K GKY     +T+K   KA +   S LK LLR GEA EK
Sbjct: 256 SNRAVCFLKLGKY----DETIKECTKALELNPSYLKALLRRGEAHEK 298


>08_02_0856 - 21928499-21929626,21929728-21929788,21929950-21930899
          Length = 712

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +3

Query: 210 VMKSGK-YCLGYKQTLKLFDKAKQSW 284
           VM  GK YCLG K  L +FD    +W
Sbjct: 546 VMFDGKFYCLGRKGNLGVFDPTSNTW 571


>02_04_0358 -
           22346745-22346804,22347268-22347273,22347439-22347527,
           22347543-22347672,22347994-22348110,22348232-22348456,
           22348549-22348761
          Length = 279

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 4/40 (10%)
 Frame = +2

Query: 566 LILFCWITMW--GTYGVV-FKL-DTALWQVRIMFSIQIFY 673
           L++ CW+ +W  G  G++ F + +   W   ++FS+ +F+
Sbjct: 40  LVMLCWMALWSFGVSGILAFHIPNGGQWWALLIFSVSLFW 79


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,251,545
Number of Sequences: 37544
Number of extensions: 346361
Number of successful extensions: 576
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 576
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2051430072
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -