SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0548 + 4099386-4099847,4100435-4101316                          248   3e-66
03_01_0547 + 4093196-4093657,4094267-4095148                          248   3e-66
03_01_0544 + 4082528-4082989,4083585-4084466                          248   3e-66
03_01_0543 + 4076981-4077442,4078145-4079026                          248   3e-66
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...   159   2e-39
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...   159   2e-39
04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...   132   2e-31
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...   110   9e-25
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...   101   4e-22
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    76   3e-14
02_04_0462 + 23131433-23132836                                         76   3e-14
02_04_0148 - 20198407-20201424                                         42   5e-04
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    41   0.001
03_05_0511 + 25056018-25059107                                         38   0.010
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    38   0.010
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    37   0.018
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    35   0.056
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    35   0.056
04_01_0103 + 1082077-1082167,1083037-1085477                           35   0.074
02_04_0017 + 18937774-18937864,18938505-18940945                       35   0.074
01_06_0662 + 30987187-30987277,30987825-30990214                       35   0.074
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    33   0.23 
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     32   0.52 
04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061     31   0.91 
01_02_0134 + 11470543-11470608,11471718-11471775,11472025-114722...    31   1.2  
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    30   2.1  
01_06_1081 + 34394971-34395139,34395261-34395310,34396057-34396365     30   2.1  
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    29   2.8  
07_03_0154 + 14509979-14512033                                         29   2.8  
09_04_0232 - 15882589-15882720,15882799-15882889,15882987-158830...    29   3.7  
08_02_0869 - 22031889-22032017,22032114-22032204,22032289-220323...    29   3.7  
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    29   3.7  
01_01_0016 - 88825-90411                                               29   3.7  
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    29   4.8  
07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950     29   4.8  
05_07_0212 + 28434612-28435931,28436012-28436044,28436557-284366...    29   4.8  
05_04_0116 + 18131510-18133192                                         29   4.8  
03_05_0744 + 27336697-27337131,27337329-27337787,27340852-273424...    29   4.8  
09_04_0737 - 19822822-19822973,19823069-19823135,19823666-198238...    28   6.4  
08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762...    28   6.4  
06_01_0839 + 6365962-6366798                                           28   6.4  
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    28   6.4  

>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/166 (74%), Positives = 134/166 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGI
Sbjct: 68  ERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 128 SKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKE 173



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/166 (74%), Positives = 134/166 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGI
Sbjct: 68  ERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 128 SKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKE 173



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/166 (74%), Positives = 134/166 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGI
Sbjct: 68  ERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 128 SKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKE 173



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/166 (74%), Positives = 134/166 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGI
Sbjct: 68  ERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 128 SKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKE 173



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score =  159 bits (387), Expect = 2e-39
 Identities = 82/170 (48%), Positives = 111/170 (65%), Gaps = 5/170 (2%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           ++N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   E
Sbjct: 247 QLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSEE 306

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           RER          +   +     +D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG
Sbjct: 307 RERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAG 366

Query: 367 ISKN-----GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           +        GQT+EHA L  + GV+QLIV VNKMD+    YS+ RFE IK
Sbjct: 367 MDGEGGKSVGQTKEHAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIK 414


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score =  159 bits (387), Expect = 2e-39
 Identities = 82/170 (48%), Positives = 111/170 (65%), Gaps = 5/170 (2%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           ++N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   E
Sbjct: 247 QLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSEE 306

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           RER          +   +     +D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG
Sbjct: 307 RERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAG 366

Query: 367 ISKN-----GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           +        GQT+EHA L  + GV+QLIV VNKMD+    YS+ RFE IK
Sbjct: 367 MDGEGGKSVGQTKEHAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIK 414


>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score =  132 bits (320), Expect = 2e-31
 Identities = 66/161 (40%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = +1

Query: 37  DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER----RYH 204
           D+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D  + ER +       
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEERLKGKTVEVG 63

Query: 205 NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 384
             +   E     +L   +   GH+ ++ NMI+G SQAD  VL+++A  GEFE G  K GQ
Sbjct: 64  RAHFETETTRFTILDAPVKMKGHKSYVPNMISGASQADIGVLVISARKGEFETGYEKGGQ 123

Query: 385 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           TREH LLA TLGV +LIV +NKMD     +S+ R++EI+ +
Sbjct: 124 TREHVLLAKTLGVAKLIVVINKMDEPTVKWSKERYDEIESK 164



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           +++  GYN    V F+PISG  G NM     K      W         DG CL E LD I
Sbjct: 168 FLRSSGYNVKKDVHFLPISGLLGSNMKTRMDKS--ICSWW--------DGPCLFEVLDCI 217

Query: 693 LPP 701
             P
Sbjct: 218 EVP 220


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score =  110 bits (265), Expect = 9e-25
 Identities = 60/129 (46%), Positives = 82/129 (63%), Gaps = 4/129 (3%)
 Frame = +1

Query: 133 MGKGSFKYAWVLDKLKAERERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGT 306
           +GKGSF YAW +D+   ERER           + +N  V+   +D+PGH+DF+ NMI+G 
Sbjct: 276 IGKGSFAYAWAMDESADERERGITMTVGVAYFDTKNYHVVL--LDSPGHKDFVPNMISGA 333

Query: 307 SQADCAVLIVAAGTGEFEAGISKN--GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 480
           +Q+D A+L++ A  G FEAG+  N  GQT+EH+ L  + GV  LIV VNKMDS E  YS+
Sbjct: 334 TQSDAAILVIDASIGSFEAGMGINGIGQTKEHSQLVRSFGVDNLIVVVNKMDSVE--YSK 391

Query: 481 PRFEEIKKE 507
            RF  IK +
Sbjct: 392 ERFNFIKSQ 400



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           ++++  GY  +AVA+VPIS    +N++  ++       W         DG CL++A+D +
Sbjct: 403 AFLRSCGYKDSAVAWVPISAMENENLMTTASDTR-LSSWY--------DGNCLLKAIDTL 453

Query: 693 LPPA 704
            PP+
Sbjct: 454 PPPS 457


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score =  101 bits (243), Expect = 4e-22
 Identities = 44/82 (53%), Positives = 62/82 (75%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQTREH LLA TLGV +L+
Sbjct: 36  LDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVLLAKTLGVSKLV 95

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V +NKMD +   +S+ R++EI+
Sbjct: 96  VVINKMDESTVGWSKERYDEIE 117


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 51/154 (33%), Positives = 73/154 (47%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E GK        +DK   E+
Sbjct: 68  VNVGTIGHVDHGKTTLTAAIT---------------KVLAEAGKAKAVAFDEIDKAPEEK 112

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E    +    H+D PGH D++KNMITG +Q D  +L+V+A  G      
Sbjct: 113 ARGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMP--- 169

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QT+EH LLA  +GV  L+  +NK+D+ + P
Sbjct: 170 ----QTKEHILLARQVGVPSLVCFLNKVDAVDDP 199


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 49/152 (32%), Positives = 73/152 (48%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T  L      +     +K+++               +D    ER
Sbjct: 71  VNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDE---------------IDAAPEER 115

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       ++E         H+D PGH D++KNMITG +Q D A+L+V+   G      
Sbjct: 116 ARGITINTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP--- 172

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QT+EH LLA  +GV +++V +NK D  +
Sbjct: 173 ----QTKEHILLAKQVGVPKIVVFLNKKDQVD 200


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GK++   HLI   G          E+   E   GS   A V+D L+ E+ 
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS---------ERRVSERMAGS---ARVMDHLEEEQR 65

Query: 193 RRYHNRYCSLEVRN*QV-----LCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  S+ +R           + ID+PGH DF   +      AD A+++V A  G
Sbjct: 66  RAITMKSASIALRRGGEDGGGHRVHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 52/168 (30%), Positives = 73/168 (43%), Gaps = 6/168 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I H+D GKST    L+   G + KR          EM K  F     LD +  ERE
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKR----------EM-KQQF-----LDNMDLERE 122

Query: 193 RRYHNRYCSLEVR---N*QVLCYH-IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +  +  +R   N +  C + ID PGH DF   +    +  + A+L+V A  G  E
Sbjct: 123 RGITIKLQAARMRYIMNDEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG-VE 181

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
           A      QT  +  LA    + ++I  +NK+D    EP       EEI
Sbjct: 182 A------QTLANVYLALENDL-EIIPVLNKIDLPGAEPDRVAQEIEEI 222


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 28/113 (24%), Positives = 49/113 (43%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GK+T   HL+  CG          +        G  ++   +D L  E+ 
Sbjct: 12  NTCILAHVDHGKTTLADHLVASCG----------DGLVHPRLAGRLRF---MDYLDEEQR 58

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++ + +       ID+PGH DF   + +    +D A+++V A  G
Sbjct: 59  RAITMKSAAVVLHHGGHRVNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEG 111


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 2/165 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+ VI HVD GK+T    L+ +CG                       +   +D +  ERE
Sbjct: 66  NVAVIAHVDHGKTTLMDRLLRQCG-------------------ADIPHERAMDSISLERE 106

Query: 193 R--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           R     ++  S+  +  ++    +D PGH DF   +       + AVL+V AG G     
Sbjct: 107 RGITIASKVTSVSWKENEL--NMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEGPL--- 161

Query: 367 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
                QT+     A   G++ +++ +NK+D   P  SE    E++
Sbjct: 162 ----AQTKFVLSKALKYGLRPILL-LNKVD--RPSVSEETCNEVE 199


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 4/134 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G    R  E  E   ++ G G+      +D +  ERE
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTG----RIHEIHEVRGRD-GVGA-----KMDSMDLERE 119

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           +    +    YC+       +    ID PGH DF   +       D A+L++ +  G   
Sbjct: 120 KGITIQSAATYCTWNGYQVNI----IDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQS 175

Query: 361 AGISKNGQTREHAL 402
             I+ + Q R + +
Sbjct: 176 QSITVDRQMRRYEI 189


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 22/83 (26%), Positives = 39/83 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++AA             QT EH      + ++ +I
Sbjct: 153 VDCPGHDILMATMLNGAAIMDGALLLIAANES------CPQPQTSEHLAAVEIMRLQHII 206

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   +  + E I+K
Sbjct: 207 ILQNKIDLIQEGAAMNQHEAIQK 229


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 51/214 (23%), Positives = 81/214 (37%), Gaps = 5/214 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+ ++GH+  GK+     L+ +   +D      F+ E +       ++    D    E+E
Sbjct: 150 NVALVGHLQHGKTVFMDMLVEQTHEVDT-----FDSEGE-------RHVRFTDTRVDEQE 197

Query: 193 RRYHNRYCSLEV-----RN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           RR   +   + +          LC  +D PGH +F   M      AD AVL+V A     
Sbjct: 198 RRVSIKAVPMSLVLEGGNGKSYLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAA---- 253

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLAT 537
             G+  N    E A+   T     ++V +NK+D        P  +   K   HT    A 
Sbjct: 254 -EGVMVN---TERAIRHATQERLPIVVVINKVDRLITELKLPPNDAYFKL-RHTLE--AI 306

Query: 538 TQLLSLSCPFLDGTETTCWSLQPKCLGSRDGRWS 639
             L+S     + GT+    +    C  S    WS
Sbjct: 307 NDLISSCSTTVGGTQLVDPAAGNVCFASGSAGWS 340


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 34.7 bits (76), Expect = 0.074
 Identities = 33/112 (29%), Positives = 47/112 (41%), Gaps = 4/112 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRT---IEKFEKEAQEMGKG-SFKYAWVLDKLK 180
           N+ VI HVD GKST T  L+   G I +     +   +  A E  +G + K   +   L 
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGI--SLF 78

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
            E        Y      N + L   ID+PGH DF   +       D A+++V
Sbjct: 79  YEMSDESLKLYKGERDGN-EYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 34.7 bits (76), Expect = 0.074
 Identities = 33/112 (29%), Positives = 47/112 (41%), Gaps = 4/112 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRT---IEKFEKEAQEMGKG-SFKYAWVLDKLK 180
           N+ VI HVD GKST T  L+   G I +     +   +  A E  +G + K   +   L 
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGI--SLF 78

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
            E        Y      N + L   ID+PGH DF   +       D A+++V
Sbjct: 79  YEMSDESLKLYKGERDGN-EYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score = 34.7 bits (76), Expect = 0.074
 Identities = 38/124 (30%), Positives = 52/124 (41%), Gaps = 12/124 (9%)
 Frame = +1

Query: 1   RHEI-NIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQE----MGKG- 144
           +H I N+ V+ HVD GKST T  L+   G I      D R  +    EA+        G 
Sbjct: 16  KHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSRSDEAERGITIKSTGI 75

Query: 145 SFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCA 324
           S  Y    + LK+ +  R  N Y          L   ID+PGH DF   +       D A
Sbjct: 76  SLYYEMSDESLKSYKGDRDGNEY----------LINLIDSPGHVDFSSEVTAALRITDGA 125

Query: 325 VLIV 336
           +++V
Sbjct: 126 LVVV 129


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 52/184 (28%), Positives = 73/184 (39%), Gaps = 17/184 (9%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I HVD GKST    L+   G I K             G G  +Y   LDKL+ ERE
Sbjct: 59  NFSIIAHVDHGKSTLADRLLELTGTIKK-------------GHGQPQY---LDKLQVERE 102

Query: 193 R-------------RYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAV 327
           R             R+ N     S +      L   ID PGH DF   +    +    A+
Sbjct: 103 RGITVKAQTATMFYRHANNQLPASDQPDAPSYLLNLIDTPGHVDFSYEVSRSLAACQGAL 162

Query: 328 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEIK 501
           L+V A  G          QT  +  LAF   +  +I  +NK+D  + +P   + + + + 
Sbjct: 163 LVVDAAQG-------VQAQTIANFYLAFESNL-SIIPVINKIDQPTADPDNVKAQLKRLF 214

Query: 502 KEDP 513
             DP
Sbjct: 215 DIDP 218


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 11/119 (9%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRT---IEKFEKEAQEMGKG--------SFKYA 159
           N+ VI HVD GKST T  L+   G I +     +   +  A E  +G        S  Y 
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTRADEAERGITIKSTGISLYYE 80

Query: 160 WVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
                L++   +R  N Y          L   ID+PGH DF   +       D A+++V
Sbjct: 81  MTDAALRSFEGKRDGNSY----------LINLIDSPGHIDFSSEVTAALRITDGALVVV 129


>04_04_0446 - 25288154-25288863,25288949-25289135,25289331-25291061
          Length = 875

 Score = 31.1 bits (67), Expect = 0.91
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +1

Query: 454 DSTEPP-YSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLD 573
           D T P    +  FE+    +P +SRR + T+ ++L CP +D
Sbjct: 609 DETSPTSILDTVFEDSNSNEPESSRRTSCTERVALRCPAID 649


>01_02_0134 +
           11470543-11470608,11471718-11471775,11472025-11472278,
           11472307-11472511,11472907-11473142
          Length = 272

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +1

Query: 376 NGQTREHALLAFTLGVKQ----LIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLAT-T 540
           N + +EH L   T G       LIV   ++D    P +EP+ +E KK   H    + T T
Sbjct: 81  NDKAKEHELPKGTEGPSTSAIVLIVSEKELDVQVVPENEPKVQEPKKSKSHQVWNVETET 140

Query: 541 QLLSLSCPFLDGTETT 588
            +    CP  +  E T
Sbjct: 141 DVYEDPCPAKNDVENT 156


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 10/22 (45%), Positives = 17/22 (77%)
 Frame = +1

Query: 19  VVIGHVDSGKSTTTGHLIYKCG 84
           V++ H+D+GK+TTT  ++Y  G
Sbjct: 108 VIMAHIDAGKTTTTERVLYYTG 129


>01_06_1081 + 34394971-34395139,34395261-34395310,34396057-34396365
          Length = 175

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 14/53 (26%), Positives = 24/53 (45%)
 Frame = +2

Query: 476 VSPDLRKSRRKILIHQEDWLQPSCCRFRAHFWMARRQHVGAFNQNALVQGMAG 634
           +  DL++S R +++  +  L  S C   A  ++ARR+  G           AG
Sbjct: 108 IESDLKRSVRMLVLENQPQLAASACEELARMYVARRRGSGTSEPRGTASSSAG 160


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/69 (30%), Positives = 29/69 (42%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G +  D  VL+VAA  G     +    +   HA  A       ++
Sbjct: 250 LDTPGHAAFSAMRARGAAVTDIVVLVVAADDGVMPQTL----EAMSHAKAANV----PIV 301

Query: 436 VGVNKMDST 462
           V VNK D +
Sbjct: 302 VAVNKCDKS 310


>07_03_0154 + 14509979-14512033
          Length = 684

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = -3

Query: 594 PTCCLRAIQKWARKRQQLGCSQSS*CMRIFLLDFLKSGLTVWWFSGIHFVYSYDELFDTE 415
           P+C  R  QK  R R ++  S+ +    +  LD +K+G  +  FSGI   +   E+    
Sbjct: 517 PSCPNRVSQKGLRNRLEVFRSRET-GWGVRSLDLIKAGTFICEFSGIVLTHQQSEIMAAN 575

Query: 414 GE 409
           G+
Sbjct: 576 GD 577


>09_04_0232 -
           15882589-15882720,15882799-15882889,15882987-15883087,
           15883494-15883592,15883693-15883830,15883918-15884508,
           15884819-15884989,15885068-15885203,15885561-15885592,
           15886280-15886336,15886434-15886686,15886762-15886850,
           15887181-15887234,15887498-15887689,15887777-15887938
          Length = 765

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 527 DWLQPSCCRFRAHFWMARRQHVGAFNQNALVQGM 628
           DW+    C   AHF   RRQ +G F   A   G+
Sbjct: 697 DWVNCGLCGEWAHFGCDRRQGLGTFKDYAKTDGL 730


>08_02_0869 -
           22031889-22032017,22032114-22032204,22032289-22032389,
           22033262-22033303,22033393-22033491,22033616-22033753,
           22033853-22034428,22034897-22035070,22035155-22035290,
           22035694-22035725,22036873-22037125,22037216-22037304,
           22037771-22037824,22038801-22038992,22039065-22039229
          Length = 756

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 527 DWLQPSCCRFRAHFWMARRQHVGAFNQNALVQGM 628
           DW+    C   AHF   RRQ +G F   A   G+
Sbjct: 689 DWVNCGLCGEWAHFGCDRRQGLGTFKDYAKTDGL 722


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH+ F      G+S  D A+L+V
Sbjct: 490 IDTPGHQSFSNLRTRGSSLCDIAILVV 516


>01_01_0016 - 88825-90411
          Length = 528

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 438 YDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSA 319
           YD  F     + +G+L  L+V+    F+ TGT + D+H A
Sbjct: 241 YDAAF--RDHARRGLLPALSVIEPRYFDLTGTPADDDHPA 278


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F      G S  D AV++V     +   G+ K  QT E   L     V+ ++
Sbjct: 508 IDTPGHESFSNMRSRGMSLCDIAVVVV-----DIMHGLEK--QTVETLALLKDRNVRFIV 560

Query: 436 VGVNKMD 456
           V +NK+D
Sbjct: 561 V-LNKVD 566


>07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950
          Length = 346

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -2

Query: 628 HPLNQGILVEGSNMLSPCHPEMGTKATAAG 539
           HP    +L  G N L+ C+P   + AT AG
Sbjct: 258 HPSLNQLLGVGDNFLAECYPSTASTATVAG 287


>05_07_0212 +
           28434612-28435931,28436012-28436044,28436557-28436670,
           28436767-28437102,28437221-28437283,28437364-28437519,
           28437650-28437715,28439074-28439310,28439403-28439678,
           28440060-28440248,28440459-28440620
          Length = 983

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 19/69 (27%), Positives = 29/69 (42%)
 Frame = +1

Query: 247 CYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 426
           C  +D PGH  F      G    D  +++V+A  G          QT E    A   GV 
Sbjct: 480 CVFLDTPGHEAFGAMRARGARVTDICIIVVSADDG-------VRPQTNEAIAHAKAAGV- 531

Query: 427 QLIVGVNKM 453
            +++ +NK+
Sbjct: 532 PIVIAINKV 540


>05_04_0116 + 18131510-18133192
          Length = 560

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 4/65 (6%)
 Frame = -1

Query: 494 SSNLGSLYGGSVE-SILFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPA---ATMS 327
           +S  G   GGS+  S+   P  S  T  V  S       P +  PA+ +P PA   ATM+
Sbjct: 66  ASGSGEGQGGSMSLSLQLRPLGSTPTAAVAVSVPPMAAAPMMAGPAAAAPAPAPPLATMA 125

Query: 326 TAQSA 312
            AQ+A
Sbjct: 126 VAQNA 130


>03_05_0744 +
           27336697-27337131,27337329-27337787,27340852-27342418,
           27342641-27343044
          Length = 954

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 11/39 (28%), Positives = 22/39 (56%)
 Frame = +1

Query: 97  RTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRY 213
           R I++  +  +E+ K S ++ +V   ++    RRYH R+
Sbjct: 121 RKIQELNRRVEEIAKRSSRFGFVSQIVRRCHRRRYHRRW 159


>09_04_0737 -
           19822822-19822973,19823069-19823135,19823666-19823822,
           19824003-19824177,19824364-19824481,19824676-19824874,
           19824983-19825062,19825141-19825257,19825791-19825961,
           19826121-19826597
          Length = 570

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%)
 Frame = +2

Query: 197 GITIDIALWKFETSKY-YVTTLMLL 268
           GIT DI LW+ E   + YVT L LL
Sbjct: 386 GITADILLWRDEKKTFSYVTVLFLL 410


>08_02_0386 -
           16575636-16575698,16575799-16575858,16575947-16576239,
           16576361-16576517,16576601-16576948,16577047-16577177,
           16577417-16577882,16578425-16579132
          Length = 741

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -3

Query: 504 LLDFLKSGLTVWWFSGIHFVY 442
           +L+    GL VW   GIHFVY
Sbjct: 234 ILEIKTGGLVVWTRGGIHFVY 254


>06_01_0839 + 6365962-6366798
          Length = 278

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 29/101 (28%), Positives = 39/101 (38%), Gaps = 5/101 (4%)
 Frame = +1

Query: 268 GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVN 447
           G R  IK + T TSQA       AA   E  +  SK     E A+  +   +++ I  V 
Sbjct: 61  GTRAGIKRLATSTSQA-LRQAAAAADDDESVSSCSKLAMDFEAAVNEYQK-IERRIAAVE 118

Query: 448 KMDST-----EPPYSEPRFEEIKKEDPHTSRRLATTQLLSL 555
           + ++       PP   P F  I     HT      TQL  L
Sbjct: 119 RQETAAAARRSPPPPTPGFNHINNNGDHTFPEQKQTQLAVL 159


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH  F      G+S  D A+L+V
Sbjct: 767 IDTPGHESFSNLRSRGSSLCDIAILVV 793


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,616,568
Number of Sequences: 37544
Number of extensions: 481983
Number of successful extensions: 1483
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1460
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1851002996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -