SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942...   135   4e-32
01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317...   135   4e-32
06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899...   133   1e-31
02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256...   133   2e-31
02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,677...    88   7e-18
01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204...    54   1e-07
11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249...    51   8e-07
01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371...    51   1e-06
04_04_0613 + 26617677-26617963,26618726-26618786,26619598-266198...    50   1e-06
02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880...    50   1e-06
03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886,309...    50   2e-06
10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212...    49   3e-06
06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244...    48   7e-06
03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009...    48   1e-05
03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572...    47   2e-05
11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973...    46   3e-05
03_05_0865 - 28365430-28367640                                         46   4e-05
01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694...    45   5e-05
01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395...    45   5e-05
01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994,524...    45   5e-05
12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638...    44   9e-05
07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025...    44   9e-05
07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159,225...    43   2e-04
01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826...    43   3e-04
08_01_0397 - 3509186-3510291,3510322-3512335                           42   5e-04
03_02_0189 - 6253659-6255380                                           42   5e-04
02_05_0064 - 25529630-25531440,25531663-25531673,25533113-255331...    40   0.002
06_03_1255 + 28780181-28781172,28782065-28782932                       39   0.003
07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397...    38   0.010
03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533...    38   0.010
02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569...    37   0.018
07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553...    36   0.024
09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436...    36   0.042
03_05_0619 - 26180980-26181105,26181329-26181417,26181518-261816...    36   0.042
08_02_0671 - 19890187-19890295,19891186-19891320,19891551-198919...    35   0.056
07_03_1566 + 27766336-27766393,27766480-27766609,27766728-277667...    34   0.097
12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269...    33   0.17 
05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53...    33   0.23 
08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310...    32   0.39 
07_03_1304 - 25629822-25629839,25630091-25631148,25631784-256349...    29   3.7  
07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194...    29   3.7  
01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993...    29   3.7  
01_06_1742 - 39585879-39585994,39586089-39586238,39586288-395863...    28   6.4  

>03_05_0052 -
           20293197-20293310,20293938-20294024,20294133-20294270,
           20295009-20295128,20295236-20295343,20296053-20296133,
           20296216-20296456,20297010-20297305
          Length = 394

 Score =  135 bits (326), Expect = 4e-32
 Identities = 58/82 (70%), Positives = 72/82 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVSAMHGDM 
Sbjct: 246 QFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTERMRSNNFTVSAMHGDMP 305

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+ IM +FR+G++RVLITT
Sbjct: 306 QKERDAIMGEFRSGATRVLITT 327



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 32/66 (48%), Positives = 38/66 (57%)
 Frame = +1

Query: 286 VSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHTSIVEMPS 465
           VS VINYDLP+NRE Y                 NFV + D R L+DIE +Y T I EMP 
Sbjct: 329 VSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKKEDIRILRDIEQYYSTQIDEMPM 388

Query: 466 DVANLI 483
           +VA+LI
Sbjct: 389 NVADLI 394


>01_06_0020 +
           25630728-25631023,25631308-25631548,25631629-25631709,
           25632109-25632216,25632329-25632448,25632806-25632943,
           25633064-25633150,25633802-25633915
          Length = 394

 Score =  135 bits (326), Expect = 4e-32
 Identities = 58/82 (70%), Positives = 72/82 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVSAMHGDM 
Sbjct: 246 QFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTERMRSNNFTVSAMHGDMP 305

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+ IM +FR+G++RVLITT
Sbjct: 306 QKERDAIMGEFRSGATRVLITT 327



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 32/66 (48%), Positives = 38/66 (57%)
 Frame = +1

Query: 286 VSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHTSIVEMPS 465
           VS VINYDLP+NRE Y                 NFV + D R L+DIE +Y T I EMP 
Sbjct: 329 VSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKKEDIRILRDIEQYYSTQIDEMPM 388

Query: 466 DVANLI 483
           +VA+LI
Sbjct: 389 NVADLI 394


>06_03_1284 -
           28988287-28988922,28989335-28989765,28989850-28989956,
           28990066-28990136
          Length = 414

 Score =  133 bits (322), Expect = 1e-31
 Identities = 59/82 (71%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ +E EEWKL+TLCDLY+TL+I Q+VIF NTRRKVDWLT+ M  RD TVSA HGDMD
Sbjct: 256 QFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMD 315

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R++IMR+FR+GSSRVLITT
Sbjct: 316 QNTRDIIMREFRSGSSRVLITT 337



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 39/76 (51%), Positives = 47/76 (61%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+  ENY                 NFVT  D R L DI+ F
Sbjct: 339 LLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRF 398

Query: 436 YHTSIVEMPSDVANLI 483
           Y+  I E+P++VA+L+
Sbjct: 399 YNVVIEELPANVADLL 414


>02_01_0355 +
           2558792-2558862,2558993-2559099,2559185-2559615,
           2560100-2560735
          Length = 414

 Score =  133 bits (321), Expect = 2e-31
 Identities = 58/82 (70%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ +E E+WKL+TLCDLY+TL+I Q+VIF NTRRKVDWLT+ M  RD TVSA HGDMD
Sbjct: 256 QFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMD 315

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R++IMR+FR+GSSRVLITT
Sbjct: 316 QNTRDIIMREFRSGSSRVLITT 337



 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 39/76 (51%), Positives = 48/76 (63%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+  ENY                 NFVT  D R L DI+ F
Sbjct: 339 LLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRF 398

Query: 436 YHTSIVEMPSDVANLI 483
           Y+ +I E+P++VA+L+
Sbjct: 399 YNVTIEELPANVADLL 414


>02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,
            6771429-6771465,6773108-6774193,6774337-6774447,
            6774701-6774817,6774818-6775120,6776092-6776513,
            6776645-6777274
          Length = 1029

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 38/82 (46%), Positives = 60/82 (73%)
 Frame = +2

Query: 8    RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
            +FY+ +E E+ KL+ LC L+DT+ I +++IF NTR     LTE +  + +TVSA+HG + 
Sbjct: 874  QFYVNVEKEDCKLDKLCGLFDTMEITRSIIFVNTRHHAKSLTEKIRGKGYTVSAIHGGIH 933

Query: 188  QREREVIMRQFRTGSSRVLITT 253
            QR R+  +++F++GSSR+LITT
Sbjct: 934  QRARDKAVQEFQSGSSRILITT 955



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/73 (34%), Positives = 35/73 (47%)
 Frame = +1

Query: 265  RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
            RGIDV +    I YDLP+    Y                 +F+T  D R    I+ F +T
Sbjct: 958  RGIDVLRAPAAIFYDLPTQPVCYLRHVQSGQHGRKGVAI-SFITSTDERVFSTIQKFCNT 1016

Query: 445  SIVEMPSDVANLI 483
             I E+PS+VA+L+
Sbjct: 1017 QIEELPSNVADLL 1029


>01_05_0292 +
           20518668-20519090,20519213-20519281,20520204-20520473,
           20520734-20521084,20521251-20521528,20522755-20523099,
           20523346-20523911,20525155-20525528
          Length = 891

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC T+R  D L  ++  R F  SA+HGD  Q ERE ++  FR+G S +L+ T
Sbjct: 396 SKVLIFCTTKRMCDQLARTL-TRQFGASAIHGDKSQSEREKVLSHFRSGRSPILVAT 451



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 18/73 (24%), Positives = 32/73 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D++ +  VINYD P+  E+Y                  F  + D +   D+     
Sbjct: 455 ARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFCDQDSKYAADLIKILE 514

Query: 442 TSIVEMPSDVANL 480
            +   +P D+A++
Sbjct: 515 GANQRVPRDLADM 527


>11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911,
            27125387-27125656,27126027-27126377,27126480-27126757,
            27126887-27128330
          Length = 1398

 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 21/57 (36%), Positives = 37/57 (64%)
 Frame = +2

Query: 83   AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
            ++ +IFC+T++  D L   +  R F  +++HGD  Q ER+ ++ QFRTG + +L+ T
Sbjct: 850  SKVIIFCSTKKMCDQLARDIG-RSFGAASIHGDKSQAERDNVLNQFRTGRAPILVAT 905



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +1

Query: 262  ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
            ARG+D++ +  VINYD P+  E+Y                  F +E D +   D+
Sbjct: 909  ARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVSYTFFSEQDWKYAGDL 963


>01_01_0509 -
           3713109-3713244,3713689-3713733,3713959-3714015,
           3714088-3714438,3714585-3714862,3714939-3715289,
           3715378-3715647,3716035-3716103,3716194-3716304,
           3716503-3716583,3716825-3716914,3717032-3717262
          Length = 689

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/57 (36%), Positives = 37/57 (64%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  ++  R +  SA+HGD  Q ER+ ++ +FR+G   +L+ T
Sbjct: 426 SKIIIFCSTKRMCDQLARNL-ARQYGASAIHGDKSQAERDSVLSEFRSGRCPILVAT 481



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ +  V+NYD P+  E+Y
Sbjct: 485 ARGLDIKDIRVVVNYDFPTGVEDY 508


>04_04_0613 +
           26617677-26617963,26618726-26618786,26619598-26619832,
           26619958-26620196,26620493-26620744,26620844-26621024,
           26621810-26621898,26622200-26622273,26622365-26622443
          Length = 498

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 27/83 (32%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T+FY  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 337 TQFYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 395

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 396 LQDHRNRVFHDFRNGACRNLVCT 418



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 32/76 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P + E Y                 N +T  DR  L  IE  
Sbjct: 420 LFTRGIDIQAVNVVINFDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQE 479

Query: 436 YHTSIVEMPSDVANLI 483
             T I  +P  +   I
Sbjct: 480 LGTEIKPIPPQIDRAI 495


>02_05_0096 +
           25785995-25786311,25786716-25786776,25787825-25788059,
           25788292-25788530,25789700-25789951,25790043-25790223,
           25790864-25790952,25791269-25791342,25791481-25791584,
           25791919-25791957,25792324-25792436
          Length = 567

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 27/83 (32%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T+FY  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 347 TQFYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 405

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 406 LQDHRNRVFHDFRNGACRNLVCT 428



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 18/51 (35%), Positives = 22/51 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADR 408
           L  RGID+Q V+ VIN+D P   E Y                 N +T  DR
Sbjct: 430 LFTRGIDIQAVNVVINFDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDR 480


>03_01_0399 +
           3097878-3098141,3098254-3098547,3098659-3098886,
           3099148-3099224,3099501-3099540,3099737-3099802,
           3100305-3100706,3100777-3100888,3101445-3101530,
           3101607-3101672
          Length = 544

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/58 (34%), Positives = 38/58 (65%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + Q +IF  T++    +  ++ L D+  S++ G +DQ ERE I+++F+ G ++VLI+T
Sbjct: 389 VGQVIIFVRTKQSTKDVHNALTLEDYVCSSIQGSLDQSEREKIIQEFKNGYTKVLIST 446



 Score = 31.5 bits (68), Expect = 0.69
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           +LARG D  QV+ VINYD+P
Sbjct: 448 VLARGFDQAQVNLVINYDMP 467


>10_08_0553 -
           18720436-18720494,18721102-18721106,18721136-18721257,
           18721390-18721478,18722136-18722316,18722403-18722654,
           18722755-18722993,18723680-18723914,18724072-18724132,
           18724632-18724987
          Length = 532

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 360 TQYYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 418

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 419 LQDHRNRVFHDFRNGACRNLVCT 441



 Score = 35.1 bits (77), Expect = 0.056
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L  RGID+Q V+ VIN+D P   E Y
Sbjct: 443 LFTRGIDIQAVNVVINFDFPKTSETY 468


>06_03_0674 +
           23422004-23422552,23423295-23423369,23424360-23424443,
           23424749-23424991,23425348-23425515,23425608-23425727,
           23426372-23427016
          Length = 627

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R+ D L   ++ + F  +A+HGD  Q+ERE  +R F+TG + +++ T
Sbjct: 380 LVFVETKREADSLRYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVAT 433



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 20/67 (29%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+DV  V+ VINYDLP + E+Y                  F TE+D    K + +   
Sbjct: 437 SRGLDVPNVAHVINYDLPKSIEDYVHRIGRTGRAGKAGSATAFFTESDHSLAKGLLELMT 496

Query: 442 TSIVEMP 462
            +  ++P
Sbjct: 497 EAKQDVP 503


>03_06_0365 -
           33399422-33399925,33400470-33400583,33400762-33400929,
           33401305-33401547,33402148-33402231,33402323-33403098,
           33404423-33404636
          Length = 700

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  ++F  T+R  D L   ++   F  +++HGD  Q+ERE  +R F++G++ +L+ T
Sbjct: 497 ALTLVFVETKRGADALENWLYTNGFPATSIHGDRTQQEREYALRSFKSGATPILVAT 553



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ VIN+DLP++ ++Y
Sbjct: 557 ARGLDIPHVAHVINFDLPNDIDDY 580


>03_02_0758 +
           10954268-10954841,10955988-10957145,10957176-10957216,
           10957412-10957448,10957534-10957954,10958201-10958234
          Length = 754

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           W LE L  + D       ++F   + +VD +   ++ R F ++A+HGD DQ  R   +++
Sbjct: 453 WLLEKLPGMIDD---GDVLVFAAKKARVDEIESQLNQRGFRIAALHGDKDQASRMETLQK 509

Query: 218 FRTGSSRVLITT 253
           F++G   VL+ T
Sbjct: 510 FKSGVYHVLVAT 521


>11_06_0300 +
           22095396-22096145,22096261-22096344,22097062-22097304,
           22098535-22098702,22098895-22099008,22099378-22099890
          Length = 623

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 18/54 (33%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D L   + +  F  +++HGD +Q+ERE  +R F++G + +L+ T
Sbjct: 420 LVFVETKRGADSLEHWLCMNGFPATSIHGDRNQQEREYALRSFKSGHTPILVAT 473



 Score = 32.7 bits (71), Expect = 0.30
 Identities = 16/68 (23%), Positives = 31/68 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V+ V+N+DLP++ ++Y                  F  E +    + + +   
Sbjct: 477 ARGLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNENNSSMARSLAELMQ 536

Query: 442 TSIVEMPS 465
            S  E+P+
Sbjct: 537 ESNQEVPA 544


>03_05_0865 - 28365430-28367640
          Length = 736

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/74 (29%), Positives = 35/74 (47%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K+  L  +   L    A++FCNT++  D   + +    F V+ +HG   Q +RE  +
Sbjct: 562 ESEKMSRLQKILTDLGDKPAIVFCNTKKSADARAKDLDKAGFRVTTLHGGKSQEQRETSL 621

Query: 212 RQFRTGSSRVLITT 253
             FR     VL+ T
Sbjct: 622 DGFRNRRFTVLVAT 635



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 18/70 (25%), Positives = 32/70 (45%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGID+  V+ VINY++PS+ + Y                 +F+T  +     D++     
Sbjct: 640 RGIDIPDVAHVINYEMPSSIDTYTHRIGRTGRAGKKGLATSFLTLENTDIFFDLKQMLIQ 699

Query: 445 SIVEMPSDVA 474
           S   +P ++A
Sbjct: 700 SNSPVPPELA 709


>01_05_0296 +
           20567259-20567386,20568895-20569123,20569205-20569436,
           20569583-20569701,20570321-20570377,20570455-20570639,
           20571416-20571560,20571630-20571713,20571798-20571861,
           20571889-20571932
          Length = 428

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + ++Y                  FV+ A D   L  +++
Sbjct: 337 LVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQE 396

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 397 RFEVDIKELPEQI 409


>01_05_0295 +
           20537147-20537291,20539111-20539283,20539365-20539596,
           20539743-20539861,20540480-20540536,20540615-20540799,
           20542252-20542396,20542463-20542546,20542634-20542697,
           20542799-20542809
          Length = 404

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + ++Y                  FV+ A D   L  +++
Sbjct: 324 LVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQE 383

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 384 RFEVDIKELPEQI 396


>01_01_0682 -
           5244805-5244919,5246468-5246613,5246813-5246994,
           5247069-5247295,5247382-5247467,5247564-5247656,
           5247964-5248118,5248407-5248490,5248589-5248768,
           5249587-5249828,5249927-5249982
          Length = 521

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 21/81 (25%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLY-DTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQ 190
           ++ I  E  K   L +L  D +  ++ +IF +T++  D +T  + +  +   ++HGD  Q
Sbjct: 287 HVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQ 346

Query: 191 REREVIMRQFRTGSSRVLITT 253
            ER+ ++ +F++G S ++  T
Sbjct: 347 AERDWVLSEFKSGKSPIMTAT 367



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV+ V  VINYD P + E+Y                  F T A+ R  KD+
Sbjct: 371 ARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDL 425


>12_02_1076 -
           25862671-25863159,25863290-25863451,25863614-25863838,
           25863939-25864037,25864584-25864992,25865094-25865221,
           25865955-25866329
          Length = 628

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R  D L+ +M  R F   A+HGD+ Q +RE  ++ FR G   +LI T
Sbjct: 344 KCIVFTQTKRDADRLSYTMG-RSFQCQALHGDITQAQRERTLKGFREGHFNILIAT 398



 Score = 27.9 bits (59), Expect = 8.5
 Identities = 10/22 (45%), Positives = 17/22 (77%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARG+D+  V  VI+++LP++ E
Sbjct: 402 ARGLDIPNVDLVIHFELPNSSE 423


>07_03_1500 +
           27001842-27002058,27002144-27002283,27002458-27002549,
           27002680-27002776,27002871-27002951,27003031-27003263,
           27003876-27004070,27004149-27004239,27004324-27004446,
           27004542-27004692,27005060-27005262
          Length = 540

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 23/70 (32%), Positives = 35/70 (50%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ARG+D + V+CVINYD P +   Y                  F TE D+  L++I + 
Sbjct: 444 VIARGMDFKGVNCVINYDFPESASAYIHRIGRSGRAGRSGEAITFFTEEDKPFLRNIANV 503

Query: 436 YHTSIVEMPS 465
             +S  E+PS
Sbjct: 504 LISSGCEVPS 513



 Score = 32.7 bits (71), Expect = 0.30
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  ++ +   L + +   D     +H D+D+ +R+  +   R G + VLI T
Sbjct: 389 LIFVQSKERAKELYKELAFDDVRADVIHADLDEEQRQDAVDNLRAGKTWVLIAT 442


>07_01_0322 -
           2258067-2258519,2258620-2258781,2258896-2259159,
           2259196-2259294,2259723-2260131,2260223-2260350,
           2261115-2261181,2262766-2262838,2262911-2263130
          Length = 624

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D L  +M  R +   A+HGD+ Q +RE  +  FR G   +L+ T
Sbjct: 352 KCIVFTQTKREADRLAYAMG-RSYACQALHGDISQNQRERTLSGFRDGRFNILVAT 406



 Score = 31.5 bits (68), Expect = 0.69
 Identities = 18/67 (26%), Positives = 27/67 (40%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VI+Y+LP+  E +                    T    RA++ IE    
Sbjct: 410 ARGLDIPNVDLVIHYELPNTSELFVHRSGRTARAGKKGSAILIYTNDQARAVRIIEQDIG 469

Query: 442 TSIVEMP 462
               E+P
Sbjct: 470 CKFTELP 476


>01_06_1758 -
           39681942-39682030,39682115-39682345,39682643-39682679,
           39683604-39683835,39683937-39684022,39684126-39684218,
           39684302-39684465,39684541-39684702,39684783-39684962,
           39685079-39685515,39685614-39685669
          Length = 588

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/64 (26%), Positives = 37/64 (57%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L D +  ++ +IF  T++  D +T  + +  +   ++HGD  Q ER+ ++ +F++G S +
Sbjct: 398 LSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPI 457

Query: 242 LITT 253
           +  T
Sbjct: 458 MAAT 461



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +1

Query: 274 DVQQVSCVINYDLPSNRENY 333
           DV+ + CVIN+D P+  E+Y
Sbjct: 483 DVKDIKCVINFDFPTTLEDY 502


>08_01_0397 - 3509186-3510291,3510322-3512335
          Length = 1039

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+++  V+NYD+P++ E+Y                  F++E + R   D+     
Sbjct: 722 ARGLDVKELELVVNYDVPNHYEDYVHRVGRTGRAGRKGFAVTFISEEEERYAPDLVKALE 781

Query: 442 TSIVEMPSDVANL 480
            S   +P D+  L
Sbjct: 782 LSEQAVPEDLKGL 794



 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +2

Query: 116 KVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           K D L + +    +   ++HG  DQ +RE  +  F++    +LI T
Sbjct: 673 KCDSLLKDLFQHGYPCLSLHGGKDQTDRESTLADFKSNVCSLLIAT 718


>03_02_0189 - 6253659-6255380
          Length = 573

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y  I   + K++TL      L     + F N  + +  +   +  R    + +HGD+ + 
Sbjct: 409 YYCISKAQHKVDTLRRCIHALEAQTVIAFMNNTKPLKDVVFKLEARGMKATELHGDLGKL 468

Query: 194 EREVIMRQFRTGSSRVLIT 250
            R  ++++F+ G  RVL+T
Sbjct: 469 ARSTVLKKFKDGEFRVLVT 487



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L ARG+DV +   VIN DLP++  +Y
Sbjct: 490 LSARGLDVPECDLVINLDLPTDSTHY 515


>02_05_0064 - 25529630-25531440,25531663-25531673,25533113-25533198,
            25533412-25534259,25535385-25535736
          Length = 1035

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/79 (22%), Positives = 36/79 (45%)
 Frame = +2

Query: 14   YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
            Y      + K++TL      L     + F N  + +  +   +  R    + +HGD+ + 
Sbjct: 871  YYCTSKAQHKVDTLRRCIHALEAQTVIAFMNNTKPLKDVVFKLEARGMKATELHGDLGKL 930

Query: 194  EREVIMRQFRTGSSRVLIT 250
             R  ++++F+ G  RVL+T
Sbjct: 931  ARSTVLKKFKDGEFRVLVT 949



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +1

Query: 256  LLARGIDVQQVSCVINYDLPSNRENY 333
            L ARG+DV +   VIN DLP++  +Y
Sbjct: 952  LSARGLDVPECDLVINLDLPTDSTHY 977


>06_03_1255 + 28780181-28781172,28782065-28782932
          Length = 619

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++FC  +  VD++ E + L+     A+HG  D  ER+   + F+     VL+ T
Sbjct: 428 LVFCEHKADVDYIQEFLLLKGVEAVAIHGGKDDEERKDAFKSFKASEKDVLVAT 481



 Score = 32.7 bits (71), Expect = 0.30
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D+  +  VINYD+P+  ENY
Sbjct: 485 SKGLDIPDIQHVINYDMPAEIENY 508


>07_03_1392 -
           26238885-26239007,26239137-26239235,26239636-26239720,
           26239825-26240028,26240360-26240682,26241904-26242575
          Length = 501

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFV-TEADRRALKDIED 432
           +RG+D+Q V  VINYD+P    +Y                 +F+ T+ D R L +IED
Sbjct: 382 SRGLDIQTVDLVINYDVPRYPRDYIHRVGRTARATRGGLSISFITTQRDIRLLHEIED 439


>03_06_0531 +
           34552206-34552598,34552665-34552735,34553363-34553369,
           34553603-34553736,34553834-34554245,34554655-34554753,
           34555059-34555283,34555652-34556029,34556412-34556555,
           34556832-34556927,34557228-34557547,34557965-34558040
          Length = 784

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R  D ++ ++        A+HGD+ Q +RE  +  FR G   VL+ T
Sbjct: 379 KTIVFTKTKRDADEVSLAL-TNSIASEALHGDISQHQRERTLNGFRQGKFTVLVAT 433



 Score = 31.9 bits (69), Expect = 0.52
 Identities = 14/56 (25%), Positives = 26/56 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D+  V  +I+Y+LP++ E +                    T + RR ++ +E
Sbjct: 437 ARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKAGTAILMFTNSQRRTVRSLE 492


>02_01_0765 -
           5694535-5694644,5695039-5696550,5697229-5697390,
           5698015-5698057
          Length = 608

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +L RG+D+ +V  VI +D+P++ + Y                  FV E DR   +++   
Sbjct: 488 VLGRGMDLLKVRQVILFDMPNSIDEYVHQVGRASRMGVEGMAIVFVNEEDRNLFRELVQI 547

Query: 436 YHTSIVEMPSDVAN 477
             T+   +P ++AN
Sbjct: 548 LKTAGAPIPRELAN 561



 Score = 35.9 bits (79), Expect = 0.032
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRD-FTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           AV+F ++R   D L+E++ +     V ++HGD    ER   +R+F TG   V++ T
Sbjct: 431 AVVFVSSRIGADLLSEAITVATGLKVVSIHGDKTMNERRESLRRFLTGEVSVVVCT 486


>07_01_0725 -
           5532803-5533324,5533631-5533657,5534285-5534398,
           5534564-5534731,5535951-5536193,5537178-5537261,
           5537357-5538117,5539637-5539730,5540633-5540899,
           5541311-5541316,5542538-5542657
          Length = 801

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 9/66 (13%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQ---------REREVIMRQFRTGSS 235
           A  ++F  T+R  D L   ++   F  +++HGD  Q         +ERE  +R F++G++
Sbjct: 583 ALTLVFVETKRGADALENWLYNNGFPATSIHGDRTQQGISKYVMKKEREYALRSFKSGAT 642

Query: 236 RVLITT 253
            +L+ T
Sbjct: 643 PILVAT 648



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ VIN+DLP++ ++Y
Sbjct: 652 ARGLDIPHVAHVINFDLPNDIDDY 675


>09_05_0008 +
           20042390-20042845,20043323-20043457,20043539-20043679,
           20043771-20043882,20044084-20044154,20044251-20044405,
           20044484-20044595,20044932-20045033,20045116-20045176,
           20045251-20045422,20045512-20045608,20045692-20045786,
           20045881-20046014,20046208-20046422
          Length = 685

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +2

Query: 167 AMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+HGD+ Q +REVI+  FR+G   VL+ T
Sbjct: 383 ALHGDVAQAQREVILAGFRSGKFLVLVAT 411


>03_05_0619 -
           26180980-26181105,26181329-26181417,26181518-26181629,
           26181711-26181848,26182004-26182150,26182458-26182532,
           26182627-26182668,26183033-26183152,26183806-26183880,
           26184051-26184113,26184690-26184759,26184877-26185006,
           26185097-26185328
          Length = 472

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+Q V  VINYD+P N ++Y
Sbjct: 343 SRGLDIQGVDVVINYDIPMNSKDY 366


>08_02_0671 -
           19890187-19890295,19891186-19891320,19891551-19891917,
           19892909-19893044,19894924-19894974,19895053-19895134,
           19895801-19895853,19895989-19896065,19896234-19896273,
           19897666-19897767,19897989-19898031,19898127-19899288,
           19899902-19900271
          Length = 908

 Score = 35.1 bits (77), Expect = 0.056
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q +IF +T+  V++L           S  +G MDQ  R + + +FR   + +LI T
Sbjct: 271 QTIIFVSTKHHVEFLNILFREEGLEPSLSYGAMDQEARNIHISKFRARKTMILIVT 326



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 16/69 (23%), Positives = 28/69 (40%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  +  V+N+D P+  + +                  FVT  D   L D+  F  
Sbjct: 330 ARGLDIPLLDNVVNWDFPAKPKLFVHRVGRVARQGRSGTAYTFVTSEDMAYLLDLHLFLS 389

Query: 442 TSIVEMPSD 468
             +   P++
Sbjct: 390 KPLRPAPTE 398


>07_03_1566 +
           27766336-27766393,27766480-27766609,27766728-27766797,
           27767134-27767196,27767741-27767815,27768035-27768154,
           27768508-27768549,27768651-27768725,27768909-27769055,
           27769165-27769302,27769448-27769562,27769658-27769746,
           27770062-27770184
          Length = 414

 Score = 34.3 bits (75), Expect = 0.097
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+Q V  VINYD P N ++Y
Sbjct: 285 SRGLDIQGVDVVINYDFPLNSKDY 308


>12_02_0340 -
           17725866-17725884,17726046-17726326,17726842-17726928,
           17727018-17727113,17728484-17728585,17728720-17728762,
           17728834-17728952,17729348-17729444,17730153-17730214,
           17730370-17730432,17730847-17730949,17731402-17731497,
           17731594-17731742,17732356-17732529,17733078-17733156,
           17733807-17733913,17733994-17734062,17734879-17735043,
           17735206-17735703
          Length = 802

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 19/55 (34%), Positives = 23/55 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARGID+  V  VIN+  P +   Y                  FVT+ DR  LK I
Sbjct: 500 ARGIDIVGVRTVINFSCPRDARTYLHRVGRTARAGREGYAVTFVTDDDRSLLKAI 554


>05_01_0079 +
           531617-531734,531987-532059,532152-532261,532400-532543,
           532628-532736,532836-533182,533260-533333,533478-533782,
           534168-534294,534385-534414,534589-534837
          Length = 561

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 18/67 (26%), Positives = 27/67 (40%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D  +V C+I YD P     Y                  F+   +   L+D+E  + 
Sbjct: 401 ARGLDFPKVKCIIQYDSPGEASEYVHRVGRTARIGEKGEALLFLQPIETDYLRDLE-LHG 459

Query: 442 TSIVEMP 462
            S+ E P
Sbjct: 460 ASLTEYP 466


>08_01_0353 -
           3107628-3107774,3108177-3108213,3108248-3109164,
           3109210-3110952
          Length = 947

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = +2

Query: 44  LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
           LE L + +D   I   ++F +++ K D L + +  R +   ++HG  DQ +RE  +  F+
Sbjct: 523 LELLGEWFDRGKI---LVFVHSQDKCDSLLKDLFQRGYPCLSLHGGKDQTDRESTLADFK 579

Query: 224 TGSSRVL 244
           +    V+
Sbjct: 580 SNLELVV 586



 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/62 (22%), Positives = 26/62 (41%)
 Frame = +1

Query: 295 VINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHTSIVEMPSDVA 474
           V+NYD+P++ E+Y                  F+++ + R   D+      S   +P D+ 
Sbjct: 585 VVNYDVPNHYEDYVHRVGRTGHAGRKGFAVTFISDEEERYAPDLAKALELSEQAVPQDLK 644

Query: 475 NL 480
            L
Sbjct: 645 GL 646


>07_03_1304 -
           25629822-25629839,25630091-25631148,25631784-25634928,
           25635454-25636293
          Length = 1686

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 12/52 (23%), Positives = 26/52 (50%)
 Frame = +2

Query: 98  FCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           F  ++ +V+W  E+    D  V  MHG +   E+ ++ + +  G  +++  T
Sbjct: 495 FLTSQLEVEWACENFSDADAVVLPMHGKLSHVEQSLVFKSY-PGKRKIIFCT 545


>07_02_0023 -
           11918735-11918827,11919139-11919231,11919320-11919484,
           11920234-11920327,11921012-11921136,11921228-11921313,
           11921786-11921864,11923777-11923857,11924153-11924260,
           11924870-11924994,11925110-11925530
          Length = 489

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V  VINY  P   E+Y
Sbjct: 380 SRGLDIPDVEVVINYSYPLTTEDY 403


>01_05_0722 +
           24598426-24598649,24599113-24599219,24599319-24599374,
           24599469-24599675,24599757-24599963,24600037-24600123,
           24600167-24600208,24600209-24600304,24600406-24600621,
           24600693-24600875,24601014-24601241
          Length = 550

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D   V+ VI   LP++RE Y
Sbjct: 401 ARGVDYPDVTLVIQVGLPADREQY 424


>01_06_1742 -
           39585879-39585994,39586089-39586238,39586288-39586375,
           39586479-39586640,39586753-39586877,39586992-39587030,
           39587290-39587476,39587643-39587713,39589371-39589564,
           39589656-39589767,39589899-39590082,39590177-39590503,
           39590780-39591061,39591148-39591621,39591730-39591813,
           39591850-39591939,39592024-39592247,39592503-39592600,
           39592679-39593169,39593249-39593520,39594266-39594522,
           39594672-39594890,39595007-39595167,39595249-39595441,
           39595528-39595633,39595947-39596121,39596404-39596556,
           39596663-39596794,39597120-39597184,39597754-39597819,
           39598433-39598511,39598587-39598767,39598864-39598976
          Length = 1889

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 268 GIDVQQVSCVINYDLPSNRENY 333
           GI V + SCVI +DLP    +Y
Sbjct: 434 GIHVPECSCVIRFDLPRTTRSY 455


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,840,198
Number of Sequences: 37544
Number of extensions: 349936
Number of successful extensions: 804
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 796
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1851002996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -