SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0316 + 33091194-33091370,33091451-33092155                       38   0.012
09_06_0176 + 21351884-21352693,21352821-21352976,21353425-213536...    37   0.021
09_04_0559 + 18516732-18516746,18516893-18517330                       33   0.19 
02_05_1303 + 35572403-35572624,35572744-35572860,35572987-355731...    32   0.59 
12_02_1123 - 26250300-26250362,26251988-26252042,26252128-262522...    31   0.78 
07_03_1260 - 25260872-25261101,25261199-25261312,25261473-252615...    31   1.0  
07_03_1157 - 24419157-24419948                                         31   1.4  
07_03_0333 - 16888606-16888740,16889463-16889570,16889691-168897...    31   1.4  
06_03_0854 + 25400855-25403741,25406174-25407708                       31   1.4  
03_01_0272 + 2105579-2105671,2105779-2105882,2106006-2107014,210...    31   1.4  
12_01_0285 + 2120130-2121204,2122842-2123116                           30   2.4  
11_01_0612 + 4902197-4902929,4903443-4904071                           30   2.4  
11_01_0277 + 2060328-2061061,2061360-2061420,2061560-2061679,206...    30   2.4  
02_04_0067 - 19425019-19425288,19425393-19425647,19425766-194259...    30   2.4  
06_03_0430 - 20710951-20711033,20711572-20712055                       29   3.1  
03_06_0297 - 32924162-32924605                                         29   3.1  
01_05_0629 + 23809899-23810720                                         29   3.1  
07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733           29   4.1  
03_05_0519 - 25131614-25134778                                         29   4.1  
02_05_0256 + 27201483-27202499,27203297-27203375,27204617-272049...    29   4.1  
02_01_0201 - 1347868-1347925,1348040-1348135,1348447-1348523,134...    29   4.1  
08_01_0601 - 5268520-5271112,5272448-5272950                           29   5.5  
04_01_0317 + 4268418-4269446                                           29   5.5  
03_05_0958 - 29200048-29200731                                         29   5.5  
01_06_0765 - 31808775-31809443,31809547-31809703,31809777-318098...    29   5.5  
10_08_0491 - 18283404-18283482,18283590-18283658,18283767-182838...    28   7.2  
08_02_1167 + 24847689-24848156                                         28   7.2  
07_02_0012 - 11770058-11770770,11770919-11771000,11771064-117710...    28   7.2  
07_01_0466 - 3518315-3521428                                           28   7.2  
01_06_1577 - 38379951-38380167,38380349-38380543,38380919-383811...    28   7.2  
12_01_0833 - 7730761-7731030,7731171-7731425,7731565-7731736,773...    28   9.6  
05_07_0257 + 28719980-28720220,28721412-28721455,28722521-287225...    28   9.6  
05_07_0174 + 28156399-28156525,28157094-28157155,28157428-28158615     28   9.6  
05_03_0033 - 7585267-7586028                                           28   9.6  
05_01_0201 - 1441063-1443836,1444658-1445758,1446367-1447179,144...    28   9.6  
04_03_0827 - 20108937-20109046,20109146-20109234,20109400-201095...    28   9.6  
02_04_0057 - 19323218-19323420,19323546-19323945                       28   9.6  

>03_06_0316 + 33091194-33091370,33091451-33092155
          Length = 293

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 29/83 (34%), Positives = 34/83 (40%)
 Frame = +2

Query: 509 AEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLAD 688
           A    + KP+A         AA  P    K       +S AAA P+     AA  PK A 
Sbjct: 128 AAAKPKAKPAAAAKPKPKPKAAAKPKAAAKPKAKAPAKSKAAAKPKAAAKPAAK-PKAAA 186

Query: 689 NPVDEDKPADISPDAPKAEAKSA 757
            P    KPA     APKA+AK A
Sbjct: 187 KPKSPAKPAAKPKAAPKAKAKPA 209


>09_06_0176 + 21351884-21352693,21352821-21352976,21353425-21353613,
            21354741-21356354,21356446-21356553,21356649-21357509,
            21357586-21357632,21358591-21358697,21359512-21359630,
            21359706-21359915,21360412-21360693,21360820-21360952,
            21361256-21361413,21362564-21362647,21362949-21363035
          Length = 1654

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = +2

Query: 533  PSATDA--EGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDED 706
            P+  DA    +AD+ AI PN+    D      SDAA I EI  P   DA  L +N  D D
Sbjct: 997  PNVDDALDNSAADNDAICPNVPDASD------SDAANIDEI-LPNVNDA--LDNNSADND 1047

Query: 707  KPADISPDAPKAEAKSADDL 766
                  PDAP ++A + D++
Sbjct: 1048 AICPNVPDAPDSDAANIDEI 1067


>09_04_0559 + 18516732-18516746,18516893-18517330
          Length = 150

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 AEISKEEKPSATDAEGSADSAAIIPNMVKKIDL-APTVESDAAAIPEIKTPEAADAPKLA 685
           AE  KE +P   + E       + P      +  A   E  A    E+K  EAA AP   
Sbjct: 71  AEEVKEAEPEPAEPEAEPAKEEVAPEPAAAAEAEAKEAEPAAQVAEEVKEEEAAPAPAAE 130

Query: 686 DNPVDEDKPADISPDAPKA 742
           +  V+E  P    P+A KA
Sbjct: 131 EVKVEEAAPV-AEPEAEKA 148


>02_05_1303 +
           35572403-35572624,35572744-35572860,35572987-35573112,
           35573217-35573279,35573837-35573944,35574587-35574664,
           35574772-35574864,35575206-35575292,35575429-35575530,
           35575617-35575736,35575839-35575901,35575974-35576119,
           35576203-35576296,35576399-35576457,35576568-35576607,
           35576694-35576785,35576877-35576946,35578172-35578333,
           35578477-35578703,35578863-35579070,35579173-35579258,
           35579450-35579541,35579674-35579870
          Length = 883

 Score = 31.9 bits (69), Expect = 0.59
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 3/84 (3%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPE---IKTPEAADAP 676
           R +   +   +A DA+ + D+ A      +K D+ P VE +   +PE   +     AD  
Sbjct: 38  RKQKKNKAASNAADADAAGDAGADDDAAEEKPDVKPQVEVEVEYVPEQADLDDGLLADFK 97

Query: 677 KLADNPVDEDKPADISPDAPKAEA 748
            + D    +D  AD   D  K EA
Sbjct: 98  SIFDKFTFKDSSADAEDDEKKDEA 121


>12_02_1123 -
           26250300-26250362,26251988-26252042,26252128-26252224,
           26252364-26253048,26253354-26253721,26253931-26254074,
           26254925-26255276
          Length = 587

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)
 Frame = +2

Query: 506 RAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAA---IPEIKTPEAADAP 676
           + ++SK E+ +  +A+ +A ++A    + +K  +A    S+AA    +  +KTP   D P
Sbjct: 140 KQKLSKAERRAIQEAQRAAKASAKEAGLSRK-SVATVSTSNAAMSKQLKTVKTPPKKDLP 198

Query: 677 KLADNPVDEDKPADISPD 730
           +L      E K ++  PD
Sbjct: 199 QLTPPVASEKKTSEHPPD 216


>07_03_1260 -
           25260872-25261101,25261199-25261312,25261473-25261596,
           25261755-25261839,25261917-25262033,25262122-25262207
          Length = 251

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +2

Query: 617 VESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSADD 763
           V+ ++ A+P   TP+ ADA   A +  D+D   D+  +  + E K+A++
Sbjct: 77  VKVESTAVPSASTPDVADAKAPAADD-DDDDDVDLFGEETEEEKKAAEE 124


>07_03_1157 - 24419157-24419948
          Length = 263

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +2

Query: 638 IPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAE 745
           +PE+  PE    P + + P  E+ P  + P+ PK E
Sbjct: 43  VPELPKPEVPPHPAVPELPKHEEPPHPVVPELPKHE 78


>07_03_0333 -
           16888606-16888740,16889463-16889570,16889691-16889790,
           16890473-16890560,16890637-16893253
          Length = 1015

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = -1

Query: 257 LSVAAATSVGLTESSILGATSRIG*AGIRPFPPPLASPNSQP 132
           ++V+   S+  T+S +L + SR+    + P PP L+S  S P
Sbjct: 12  VAVSGELSISATQSRLLPSASRVHLPHLLPAPPALSSSRSHP 53


>06_03_0854 + 25400855-25403741,25406174-25407708
          Length = 1473

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 4/82 (4%)
 Frame = +2

Query: 533 PSATDAEGSADSAAIIPN----MVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVD 700
           PSA  A   A + ++ PN     V    LAP   + AAA P +  P AA    L   P  
Sbjct: 618 PSAAPAPAPASAPSLEPNDIIAPVVSSTLAPGASAAAAAAPAVAPPAAALEAILIPMPPP 677

Query: 701 EDKPADISPDAPKAEAKSADDL 766
               A  +P   K + ++A  L
Sbjct: 678 AAAAAAAAPVPKKRKVRTASTL 699


>03_01_0272 +
           2105579-2105671,2105779-2105882,2106006-2107014,
           2107130-2107153
          Length = 409

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +2

Query: 593 KKIDLAPTVES-DAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEA 748
           KK+   P V + +AAAIPE +  +  +A   A +  DE +   ++PD  K+EA
Sbjct: 79  KKVTFDPNVTTYEAAAIPEAEEEDDEEAEPAAGDDKDEARWM-LAPDCAKSEA 130


>12_01_0285 + 2120130-2121204,2122842-2123116
          Length = 449

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = +2

Query: 653 TPEAADAPKLADNPVDED-KPADISPDAPKAEAKSAD 760
           TP AAD P L D P     +P     DA  A+A  AD
Sbjct: 32  TPSAADTPNLPDTPASASAEPETPFSDAALADASDAD 68


>11_01_0612 + 4902197-4902929,4903443-4904071
          Length = 453

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = +2

Query: 566 SAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLAD 688
           +AA  PN V  ID+       AAA P  + PEAA  P L D
Sbjct: 25  AAAAAPNQVA-IDVVVVHHHGAAAAPGQQAPEAAPVPHLLD 64


>11_01_0277 +
           2060328-2061061,2061360-2061420,2061560-2061679,
           2061947-2062112,2062229-2062635
          Length = 495

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +2

Query: 653 TPEAADAPKLADNPVDEDKPADISPDAPKAEAKSADD 763
           TP AAD P L D P      A   PD P ++A  A D
Sbjct: 32  TPSAADTPNLPDTPAS----ASAEPDTPFSDAALAAD 64


>02_04_0067 -
           19425019-19425288,19425393-19425647,19425766-19425937,
           19426069-19426302,19426523-19426656,19427663-19427746,
           19428355-19428645,19428788-19429120,19429317-19429390,
           19429464-19429644,19429993-19430096,19430232-19430392,
           19430727-19431040,19431583-19431864,19432431-19432732,
           19433176-19433266,19433368-19433421,19438917-19438993,
           19439081-19439240,19439410-19439494,19439574-19440130
          Length = 1404

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -1

Query: 326 IVLFGLWYSGYLVVTNWSRFGFLLSVAAATSVGLTESSIL 207
           I+LFG +    L + NW ++GF +S  +   +GLT +  L
Sbjct: 684 ILLFGGFIIPRLSMPNWLKWGFWISPLSYAEIGLTGNEFL 723


>06_03_0430 - 20710951-20711033,20711572-20712055
          Length = 188

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +2

Query: 575 IIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAP 736
           I P + + +   PTVE   A + +      +   +LA NP+   KPAD+ P  P
Sbjct: 32  IKPMVAELVGWKPTVEKTVAELRDEMGELRSQVQQLAKNPMLLVKPADLPPLLP 85


>03_06_0297 - 32924162-32924605
          Length = 147

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 25/77 (32%), Positives = 30/77 (38%), Gaps = 1/77 (1%)
 Frame = +2

Query: 518 SKEEKPSA-TDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNP 694
           S EE PS  T  E  A     +P M       P  E    +IP    PE  D P+  D P
Sbjct: 57  SLEELPSIDTPPEFEAPPGLDVP-MPPPGAPTPGPEQPGPSIPSPPMPEVPDVPRNPDVP 115

Query: 695 VDEDKPADISPDAPKAE 745
               KP ++ P  P  E
Sbjct: 116 --PPKPPELDPPRPPPE 130


>01_05_0629 + 23809899-23810720
          Length = 273

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 24/75 (32%), Positives = 32/75 (42%)
 Frame = +2

Query: 533 PSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKP 712
           P AT A+ S  S A         D +   E+D AA    +  EA  AP+      D  +P
Sbjct: 133 PRATSADASEPSEAD----PAATDASEPSEADPAATDASEPSEADPAPRATS--ADASEP 186

Query: 713 ADISPDAPKAEAKSA 757
           ++  P A  A A SA
Sbjct: 187 SEADPAATAASASSA 201


>07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733
          Length = 181

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 6/61 (9%)
 Frame = +2

Query: 551 EGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKT----PEAADAPKLADNPVD--EDKP 712
           +GSA S  I  N  + ++L    +  A  I +       P A D P LAD P +  ED+P
Sbjct: 82  DGSAASFGISINHTRALELPGVCKVQAPPISQCTAVPTPPPAPDTPTLADEPAETNEDEP 141

Query: 713 A 715
           +
Sbjct: 142 S 142


>03_05_0519 - 25131614-25134778
          Length = 1054

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 2/75 (2%)
 Frame = +2

Query: 533 PSATDAEGSADSAAIIPNMVK--KIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDED 706
           P A  A+G AD+AA      +  K +      + AA+  E K PEA    K A+    E+
Sbjct: 150 PPAAPADGKADAAAEKKEAAEGGKEEKEKAPAAAAASAAEEKKPEAPAEEKKAEEAKKEE 209

Query: 707 KPADISPDAPKAEAK 751
           K    S +A K E K
Sbjct: 210 KK---SAEADKKEEK 221


>02_05_0256 +
           27201483-27202499,27203297-27203375,27204617-27204946,
           27205029-27205198
          Length = 531

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)
 Frame = -1

Query: 254 SVAAATSVGLTESSILGATSRIG*AGI---RPFPPPLASPNSQPRRLCTIVRPSS 99
           S +AA   G++  SI  AT+R+  A      P P    +P++ PR      +PSS
Sbjct: 201 SASAAVFSGVSSLSIAAATARVEVAATPCWMPSPARFTTPSATPRHHIITTKPSS 255


>02_01_0201 -
           1347868-1347925,1348040-1348135,1348447-1348523,
           1349385-1349453,1349576-1349629,1350295-1350350,
           1350487-1350694,1350978-1351066,1351163-1351187
          Length = 243

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = -2

Query: 502 ACTSVFESSG*AAGSSTLISADFASASGISDDF 404
           +CT +F+SS  +A  +  ++A FA AS   D+F
Sbjct: 64  SCTYIFDSSDASASGAADVAATFAKASRKMDEF 96


>08_01_0601 - 5268520-5271112,5272448-5272950
          Length = 1031

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +3

Query: 462 PAAQPEDSKTEVQATVLKFQKKKNLVLLMQKVLPTQLPSFPT 587
           PAA  E + T  + T  K  K K +   M K+L   +   PT
Sbjct: 449 PAAASETAPTSTEQTTKKKMKGKQMATSMDKILTVCMDDLPT 490


>04_01_0317 + 4268418-4269446
          Length = 342

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 22/66 (33%), Positives = 27/66 (40%)
 Frame = +2

Query: 560 ADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPK 739
           A  AA+ P    KI   PT+   AAA  E K P+ +     A  P+  D      P  PK
Sbjct: 161 APPAAMEPAADDKIK--PTIPETAAAAAEEKPPKPSPPRPPASRPIATDPTVLAIPVIPK 218

Query: 740 AEAKSA 757
            E   A
Sbjct: 219 QEVLDA 224


>03_05_0958 - 29200048-29200731
          Length = 227

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 5/53 (9%)
 Frame = +2

Query: 602 DLAPTVESDAAA-----IPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAE 745
           D  P ++SDA A     +P+ +TP     PKL        KPA   P  P+++
Sbjct: 90  DADPLMKSDAPAPPAEKLPQPQTPTPTGTPKLQAAERKAQKPAKEPPSPPRSQ 142


>01_06_0765 -
           31808775-31809443,31809547-31809703,31809777-31809894,
           31810170-31810308
          Length = 360

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 16/67 (23%), Positives = 28/67 (41%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           E+ K  +  AT      D+   +    K++    +  S AAA P   +P A + PK  + 
Sbjct: 159 ELKKLREQLATAEAAKKDAQVALEEAKKRVGTKGSPASAAAASPRSPSPVAVETPKKTEQ 218

Query: 692 PVDEDKP 712
            +   +P
Sbjct: 219 QLKVTEP 225


>10_08_0491 -
           18283404-18283482,18283590-18283658,18283767-18283883,
           18283953-18284068,18284149-18284223,18284248-18284430,
           18284530-18284591,18284668-18285606,18285723-18285846,
           18285917-18286060,18286151-18286225,18286359-18286382,
           18287025-18287095,18287305-18287407,18287555-18287781,
           18287910-18288027,18288220-18288311,18288793-18288874
          Length = 899

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 16/60 (26%), Positives = 28/60 (46%)
 Frame = +2

Query: 530 KPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDK 709
           K SA  +EGS+    ++P  + K+D  P +         I  P+  +   LA +  ++DK
Sbjct: 464 KISAYSSEGSSFIPVVVPRHIPKVDSGPNLSKVLTTDLTIVEPQDIERGGLAVDCGEDDK 523


>08_02_1167 + 24847689-24848156
          Length = 155

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +3

Query: 402 AKSSEIPDAEAKSADIKVEEPAAQPEDSKTEVQA 503
           AK  E P+AEA++A   VEE AA P +   E +A
Sbjct: 108 AKEPE-PEAEAEAAAAPVEEAAAAPVEVAEEAEA 140


>07_02_0012 -
           11770058-11770770,11770919-11771000,11771064-11771072,
           11771630-11771877,11772006-11772183,11772270-11772278
          Length = 412

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +1

Query: 178 PAQPILEVAPKIDDSVKPTEVAAATE 255
           P  P  E  PK+DD  +P +VA +TE
Sbjct: 222 PLPPPSESPPKVDDDNEPPKVAGSTE 247


>07_01_0466 - 3518315-3521428
          Length = 1037

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +2

Query: 665 ADAPKLADNPVDEDKPADISPDAPKAEAKSADD 763
           A  P   + P  +  PA+ +PDAP A+A +A +
Sbjct: 144 APPPPPPEPPAADPAPAEAAPDAPPADADAAPE 176


>01_06_1577 -
           38379951-38380167,38380349-38380543,38380919-38381191,
           38381281-38381455,38381925-38382035,38382120-38382390,
           38382990-38383139,38383242-38384246
          Length = 798

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = +2

Query: 524 EEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIP-EIKTPEAADAPKLADNPVD 700
           +E+P+  +   S ++AA   N  + +D     +++  A+P E      ++  K ++N V 
Sbjct: 51  KEQPARVNYGASEEAAAASGNSAEGVDRFGDTDNNDNAVPEEPNNTVPSEEEKFSENTV- 109

Query: 701 EDKPADISPD-APKAEAKSADD 763
            +KP + S + AP  E + + D
Sbjct: 110 -EKPVESSEEKAPPKEKEESKD 130


>12_01_0833 -
           7730761-7731030,7731171-7731425,7731565-7731736,
           7731873-7732106,7732362-7732495,7734116-7734199,
           7735086-7735376,7735566-7735898,7736351-7736424,
           7736558-7736653,7736876-7737029,7737118-7737221,
           7737325-7737485,7737774-7738087,7738950-7739231,
           7739909-7740210,7740513-7740713,7740924-7741014,
           7741424-7741500,7741595-7741754,7742026-7742110,
           7742194-7742288
          Length = 1322

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -1

Query: 326 IVLFGLWYSGYLVVTNWSRFGFLLSVAAATSVGLTESSIL 207
           I+LFG +      + NW ++GF LS  +   +GLT +  L
Sbjct: 579 ILLFGGFLIPRPSMPNWLKWGFWLSPLSYAEIGLTGNEFL 618


>05_07_0257 +
           28719980-28720220,28721412-28721455,28722521-28722590,
           28722693-28722816,28723420-28724060,28725100-28725364,
           28725434-28725713,28726042-28726209,28726867-28727358,
           28727432-28727689
          Length = 860

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%)
 Frame = +1

Query: 145 GDASGGGKGRIPAQPILEVAPK--IDDSVK---PTEVAAATERRKPN 270
           GD++G GKG    +  L   PK  + DSVK   PTE  +A +    N
Sbjct: 119 GDSTGSGKGPTKKETELHSLPKSSVSDSVKESNPTEKISAADHATIN 165


>05_07_0174 + 28156399-28156525,28157094-28157155,28157428-28158615
          Length = 458

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 17/52 (32%), Positives = 26/52 (50%)
 Frame = +3

Query: 420 PDAEAKSADIKVEEPAAQPEDSKTEVQATVLKFQKKKNLVLLMQKVLPTQLP 575
           P+AE K    ++  P AQP+     ++A V+    + +L  L    LP QLP
Sbjct: 44  PNAEPKRPSSQI--PTAQPDPMVDRLRALVVNRSWRTSLQALPPPPLPPQLP 93


>05_03_0033 - 7585267-7586028
          Length = 253

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 5/54 (9%)
 Frame = +2

Query: 611 PTVESDAAAIPEIKT-----PEAADAPKLADNPVDEDKPADISPDAPKAEAKSA 757
           P  ES A   PE K+     PE    P+    P  E KP      APK E  S+
Sbjct: 197 PKSESKAEPKPERKSYSKSKPEPESKPEAKTEPQPESKPEPKPESAPKKETPSS 250


>05_01_0201 -
           1441063-1443836,1444658-1445758,1446367-1447179,
           1447386-1447440
          Length = 1580

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +2

Query: 509 AEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPE---IKTPEAADAP- 676
           AE   E  P+AT+ +G   + A  P +      +PT  +   A P      +P AA +P 
Sbjct: 224 AEAVAEGSPTATEQKGITHTPAPAPCVSPVAAPSPTPCASPVAAPSPAPCVSPVAAPSPA 283

Query: 677 KLADNPVDEDKPADIS 724
               +PV EDK  +++
Sbjct: 284 PPCKSPVPEDKSCELT 299


>04_03_0827 -
           20108937-20109046,20109146-20109234,20109400-20109548,
           20109801-20109942,20110530-20110645,20111141-20111458
          Length = 307

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = -1

Query: 257 LSVAAATSVGLTESSILGAT-SRIG*AGIRPFPPPLASPNSQPRRLCT 117
           +  A AT+VG  +   LG     +   G  PFP P   P + P  L +
Sbjct: 54  VEAAVATAVGAVQGGALGGLMGTLAPDGGSPFPVPQPPPGADPNALAS 101


>02_04_0057 - 19323218-19323420,19323546-19323945
          Length = 200

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 4/81 (4%)
 Frame = +1

Query: 115 IVHSLRGCEFGDASGGGKGRIPAQP---ILEVAPKIDDSVKPTEVAAATERRKPNLLQLV 285
           ++  LRG  F    GGG+GR PA P   +L VA  +  S+ P  V A   R + ++  LV
Sbjct: 47  LLAGLRGQSF--RRGGGEGRAPAGPSRVLLTVA--VRQSMWPLHVMA---RAEWSVADLV 99

Query: 286 TTRYPLYQRP-KRTI*PQKTP 345
                LY R  +R + P   P
Sbjct: 100 AAAVELYIREGRRPLLPSADP 120


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,135,179
Number of Sequences: 37544
Number of extensions: 325829
Number of successful extensions: 1492
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 1383
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1488
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2091906552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -