SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0548 + 4099386-4099847,4100435-4101316                          204   4e-53
03_01_0547 + 4093196-4093657,4094267-4095148                          204   4e-53
03_01_0544 + 4082528-4082989,4083585-4084466                          204   4e-53
03_01_0543 + 4076981-4077442,4078145-4079026                          204   4e-53
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...   113   1e-25
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...   113   1e-25
04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...    95   5e-20
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...    76   3e-14
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...    73   3e-13
02_04_0462 + 23131433-23132836                                         69   3e-12
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    67   1e-11
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    44   1e-04
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     42   7e-04
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    41   9e-04
04_01_0103 + 1082077-1082167,1083037-1085477                           40   0.002
02_04_0017 + 18937774-18937864,18938505-18940945                       40   0.002
02_04_0148 - 20198407-20201424                                         39   0.005
01_06_0662 + 30987187-30987277,30987825-30990214                       38   0.006
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    38   0.011
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    37   0.014
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    37   0.019
03_05_0511 + 25056018-25059107                                         36   0.025
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    35   0.058
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    33   0.24 
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    31   0.95 
05_07_0212 + 28434612-28435931,28436012-28436044,28436557-284366...    25   1.5  
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    30   1.7  
02_04_0064 - 19375497-19375580,19375659-19375733,19376359-193765...    30   2.2  
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    29   2.9  
09_01_0129 - 1954470-1955129,1956285-1956371,1956475-1956663,195...    29   5.1  
08_02_0453 - 17331534-17331656,17332288-17332340,17332612-173327...    29   5.1  
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    28   6.7  
08_02_0386 - 16575636-16575698,16575799-16575858,16575947-165762...    28   6.7  
03_04_0206 - 18493178-18495310                                         28   6.7  
09_04_0483 + 17979566-17980019,17980242-17980321,17980431-179808...    28   8.8  
04_03_0106 + 11325172-11325379,11326590-11326640,11326987-113270...    28   8.8  
03_05_0339 + 23287620-23287676,23287784-23287849,23287937-232880...    28   8.8  

>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score =  204 bits (499), Expect = 4e-53
 Identities = 100/133 (75%), Positives = 107/133 (80%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  113 bits (271), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score =  204 bits (499), Expect = 4e-53
 Identities = 100/133 (75%), Positives = 107/133 (80%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  113 bits (271), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score =  204 bits (499), Expect = 4e-53
 Identities = 100/133 (75%), Positives = 107/133 (80%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  113 bits (271), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score =  204 bits (499), Expect = 4e-53
 Identities = 100/133 (75%), Positives = 107/133 (80%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  113 bits (271), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score =  113 bits (273), Expect = 1e-25
 Identities = 56/128 (43%), Positives = 82/128 (64%), Gaps = 2/128 (1%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E  K   +    W     
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKE--KGKGSFAYAWAMDES 303

Query: 307 SVSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           S     G+T+ +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG F
Sbjct: 304 SEERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSF 363

Query: 481 EAGISKNG 504
           EAG+   G
Sbjct: 364 EAGMDGEG 371



 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHA L  + GV+QLIV VNKMD+    YS+ RFE IK ++ S+++   +  ++V ++P+
Sbjct: 379 KEHAQLIRSFGVEQLIVAVNKMDAIG--YSKERFEFIKVQLGSFLRSCNFKDSSVTWIPL 436

Query: 690 SGWHGDNMLE 719
           S     N+++
Sbjct: 437 SAVENQNLIK 446


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score =  113 bits (273), Expect = 1e-25
 Identities = 56/128 (43%), Positives = 82/128 (64%), Gaps = 2/128 (1%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E  K   +    W     
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKE--KGKGSFAYAWAMDES 303

Query: 307 SVSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           S     G+T+ +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG F
Sbjct: 304 SEERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSF 363

Query: 481 EAGISKNG 504
           EAG+   G
Sbjct: 364 EAGMDGEG 371



 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHA L  + GV+QLIV VNKMD+    YS+ RFE IK ++ S+++   +  ++V ++P+
Sbjct: 379 KEHAQLIRSFGVEQLIVAVNKMDAIG--YSKERFEFIKVQLGSFLRSCNFKDSSVTWIPL 436

Query: 690 SGWHGDNMLE 719
           S     N+++
Sbjct: 437 SAVENQNLIK 446


>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 49/121 (40%), Positives = 71/121 (58%), Gaps = 4/121 (3%)
 Frame = +1

Query: 160 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIA 339
           D+GKST  G +++  G +D RTI+K+EKEA++  ++   M             G T+++ 
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEERLKGKTVEVG 63

Query: 340 LWKFETSKYYVTIIDAP----GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 507
              FET     TI+DAP    GH+ ++ NMI+G SQAD  VL+++A  GEFE G  K GQ
Sbjct: 64  RAHFETETTRFTILDAPVKMKGHKSYVPNMISGASQADIGVLVISARKGEFETGYEKGGQ 123

Query: 508 T 510
           T
Sbjct: 124 T 124



 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REH LLA TLGV +LIV +NKMD     +S+ R++EI+ ++  +++  GYN    V F+P
Sbjct: 125 REHVLLAKTLGVAKLIVVINKMDEPTVKWSKERYDEIESKMVPFLRSSGYNVKKDVHFLP 184

Query: 687 ISGWHGDNM 713
           ISG  G NM
Sbjct: 185 ISGLLGSNM 193


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 29/62 (46%), Positives = 46/62 (74%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GIT+ + +  F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  
Sbjct: 297 GITMTVGVAYFDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGI 356

Query: 499 NG 504
           NG
Sbjct: 357 NG 358



 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 31/69 (44%), Positives = 46/69 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH+ L  + GV  LIV VNKMDS E  YS+ RF  IK ++ ++++  GY  +AVA+VPI
Sbjct: 363 KEHSQLVRSFGVDNLIVVVNKMDSVE--YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPI 420

Query: 690 SGWHGDNML 716
           S    +N++
Sbjct: 421 SAMENENLM 429



 Score = 33.5 bits (73), Expect = 0.18
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERER 317
           +GKGSF YAW +D+   ERER
Sbjct: 276 IGKGSFAYAWAMDESADERER 296


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 31/64 (48%), Positives = 43/64 (67%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  +
Sbjct: 16  GKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYER 75

Query: 499 NGQT 510
            GQT
Sbjct: 76  GGQT 79



 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REH LLA TLGV +L+V +NKMD +   +S+ R++EI+ ++  ++K  GYN    V F+P
Sbjct: 80  REHVLLAKTLGVSKLVVVINKMDESTVGWSKERYDEIEGKMVPFLKSSGYNVKKDVHFLP 139

Query: 687 ISGWHGDNM 713
           ISG  G NM
Sbjct: 140 ISGLLGTNM 148


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 42/122 (34%), Positives = 61/122 (50%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  + K H+NI  IGHVD GK+T T  L      +     +K++    E    P      
Sbjct: 63  KFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYD----EIDAAPEER--- 115

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                   + GITI+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+  
Sbjct: 116 --------ARGITINTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGA 167

Query: 469 TG 474
            G
Sbjct: 168 DG 169



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFE-EIKKEVSSY 641
           +EH LLA  +GV +++V +NK D  +        E E+++ +SSY
Sbjct: 175 KEHILLAKQVGVPKIVVFLNKKDQVDDEELLQLVELEVRELLSSY 219


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 42/119 (35%), Positives = 60/119 (50%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H+N+  IGHVD GK+T T  +        K     F+    E  K P         
Sbjct: 63  RTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFD----EIDKAPEEK------ 112

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                + GITI  A  ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+A  G
Sbjct: 113 -----ARGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDG 166



 Score = 32.3 bits (70), Expect = 0.41
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH LLA  +GV  L+  +NK+D+ + P      E   +E+ S+ K  G     +    +
Sbjct: 172 KEHILLARQVGVPSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDEIPIIRGSAL 231

Query: 690 SGWHGDN 710
           S   G N
Sbjct: 232 SALQGTN 238


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 37/124 (29%), Positives = 54/124 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I     E  E   ++ V    + +       L   
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTGRIH----EIHEVRGRDGVGAKMDSMD------LERE 119

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            GITI  A      + Y V IID PGH DF   +       D A+L++ +  G     I+
Sbjct: 120 KGITIQSAATYCTWNGYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 179

Query: 496 KNGQ 507
            + Q
Sbjct: 180 VDRQ 183


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 39/126 (30%), Positives = 56/126 (44%), Gaps = 10/126 (7%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K+    N+ VI HVD GKST T  L+   G I      D R  +    EA+  +   S
Sbjct: 13  MDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTRADEAERGITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSK----YYVTIIDAPGHRDFIKNMITGTSQAD 441
                     +S+   +T D AL  FE  +    Y + +ID+PGH DF   +       D
Sbjct: 73  T--------GISLYYEMT-DAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALRITD 123

Query: 442 CAVLIV 459
            A+++V
Sbjct: 124 GALVVV 129


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 29/113 (25%), Positives = 49/113 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+     L+ +   +D      F+ E +  V+     +      R+S+ 
Sbjct: 150 NVALVGHLQHGKTVFMDMLVEQTHEVDT-----FDSEGERHVRFTDTRVDEQER-RVSIK 203

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             + + + L       Y   I+D PGH +F   M      AD AVL+V A  G
Sbjct: 204 A-VPMSLVLEGGNGKSYLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAAEG 255


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K+    N+ VI HVD GKST T  L+   G I      D R  +    EA+  +   S
Sbjct: 13  MDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +    +S     ++ +   + + ++Y + +ID+PGH DF   +       D A++
Sbjct: 73  TGISLFY--EMSDE---SLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALRITDGALV 127

Query: 454 IV 459
           +V
Sbjct: 128 VV 129


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K+    N+ VI HVD GKST T  L+   G I      D R  +    EA+  +   S
Sbjct: 13  MDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +    +S     ++ +   + + ++Y + +ID+PGH DF   +       D A++
Sbjct: 73  TGISLFY--EMSDE---SLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALRITDGALV 127

Query: 454 IV 459
           +V
Sbjct: 128 VV 129


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 31/113 (27%), Positives = 49/113 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  ++ HVD GK++   HLI   G  ++R  E+    A+  V D           R    
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS-ERRVSERMAGSAR--VMDHLEE----EQRRAITM 70

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
              +I +     +   + V +ID+PGH DF   +      AD A+++V A  G
Sbjct: 71  KSASIALRRGGEDGGGHRVHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K+    N+ V+ HVD GKST T  L+   G I      D R  +    EA+  +   S
Sbjct: 13  MDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSRSDEAERGITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  +    +S     ++       + ++Y + +ID+PGH DF   +       D A++
Sbjct: 73  TGISLYY--EMSDE---SLKSYKGDRDGNEYLINLIDSPGHVDFSSEVTAALRITDGALV 127

Query: 454 IV 459
           +V
Sbjct: 128 VV 129


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK--EAQEWVKDPSNMLGYWTN*R 303
           HI+ V++ H+D+GK+TTT  ++Y  G   K  I +F++     +W++             
Sbjct: 105 HIS-VIMAHIDAGKTTTTERVLYYTGRNYK--IGEFQEGTVTMDWMEQEQER-------- 153

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
             +++      A W    +K+ + IID PGH DF   +       D A++ +
Sbjct: 154 -GITITSPPTTAFW----NKHRINIIDTPGHVDFTLEVERALRVLDGAIMSI 200


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 37.1 bits (82), Expect = 0.014
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 2/115 (1%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           N+ VI HVD GK+T    L+ +CG     +R ++    E +  +   S +         S
Sbjct: 66  NVAVIAHVDHGKTTLMDRLLRQCGADIPHERAMDSISLERERGITIASKVT--------S 117

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           VS         WK    +  + ++D PGH DF   +       + AVL+V AG G
Sbjct: 118 VS---------WK----ENELNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEG 159


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 33/117 (28%), Positives = 51/117 (43%), Gaps = 4/117 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I H+D GKST    L+   G + KR ++      Q+++    NM        L   
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKREMK------QQFL---DNM-------DLERE 122

Query: 316 VGITIDIALWKFE----TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI +   +         Y + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 123 RGITIKLQAARMRYIMNDEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 179


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 36.3 bits (80), Expect = 0.025
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 2/115 (1%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGG--IDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           N  ++ HVD GK+T   HL+  CG   +  R   +      +++ +              
Sbjct: 12  NTCILAHVDHGKTTLADHLVASCGDGLVHPRLAGRL--RFMDYLDEEQRR---------- 59

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               IT+  A        + V +ID+PGH DF   + +    +D A+++V A  G
Sbjct: 60  ---AITMKSAAVVLHHGGHRVNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEG 111


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 35.1 bits (77), Expect = 0.058
 Identities = 32/121 (26%), Positives = 50/121 (41%), Gaps = 8/121 (6%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDK-----RTIEKFEKEAQEWVK---DPSNMLGYW 291
           N  +I HVD GKST    L+   G I K     + ++K + E +  +      + M    
Sbjct: 59  NFSIIAHVDHGKSTLADRLLELTGTIKKGHGQPQYLDKLQVERERGITVKAQTATMFYRH 118

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
            N +L  S          + +   Y + +ID PGH DF   +    +    A+L+V A  
Sbjct: 119 ANNQLPASD---------QPDAPSYLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQ 169

Query: 472 G 474
           G
Sbjct: 170 G 170


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 33.1 bits (72), Expect = 0.24
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GIT  I  +  E  S   +T +D PGH  F      G +  D  VL+VAA  G
Sbjct: 229 GITQHIGAFVVEMPSGASITFLDTPGHAAFSAMRARGAAVTDIVVLVVAADDG 281


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 31.1 bits (67), Expect = 0.95
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           +V+ +D PGH   +  M+ G +  D A+L++AA
Sbjct: 149 HVSFVDCPGHDILMATMLNGAAIMDGALLLIAA 181


>05_07_0212 +
           28434612-28435931,28436012-28436044,28436557-28436670,
           28436767-28437102,28437221-28437283,28437364-28437519,
           28437650-28437715,28439074-28439310,28439403-28439678,
           28440060-28440248,28440459-28440620
          Length = 983

 Score = 25.4 bits (53), Expect(2) = 1.5
 Identities = 12/55 (21%), Positives = 24/55 (43%)
 Frame = +1

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++ GI     + + + + +    +D PGH  F      G    D  +++V+A  G
Sbjct: 460 ITQGIGAYQVIVQVDGNPHACVFLDTPGHEAFGAMRARGARVTDICIIVVSADDG 514



 Score = 23.4 bits (48), Expect(2) = 1.5
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = +1

Query: 139 IVVIGHVDSGKSTTTGHL 192
           + ++GHVD GK+T   ++
Sbjct: 430 VTIMGHVDHGKTTLLDYI 447


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH+ F      G+S  D A+L+V
Sbjct: 489 VIDTPGHQSFSNLRTRGSSLCDIAILVV 516


>02_04_0064 -
           19375497-19375580,19375659-19375733,19376359-19376514,
           19377016-19377093,19377328-19377428,19377570-19377717,
           19378172-19378316,19378803-19378906,19380257-19380385,
           19380526-19380636,19380734-19380863,19381915-19382034,
           19382360-19382481,19382965-19383048,19383241-19383357,
           19383442-19383522,19384138-19384197,19384398-19384440,
           19384528-19384626,19385353-19385564,19385964-19386091,
           19386246-19386396
          Length = 825

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 6/59 (10%)
 Frame = +3

Query: 573 MDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAV------AFVPISGWHGDNMLEPSTK 731
           M STEP  +   +   + EV   IKK+GYN   +      A+    G+H  N   PS++
Sbjct: 322 MSSTEPKINT--YANFRDEVLPRIKKLGYNAVQIMAIQEHAYYGSFGYHVTNFFAPSSR 378


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH  F      G+S  D A+L+V
Sbjct: 766 VIDTPGHESFSNLRSRGSSLCDIAILVV 793


>09_01_0129 -
           1954470-1955129,1956285-1956371,1956475-1956663,
           1956772-1956900,1957386-1957472,1957572-1958036,
           1959844-1959923,1961295-1961358,1961444-1961455
          Length = 590

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 5/47 (10%)
 Frame = -2

Query: 689 NGHESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGI-----HFVY 564
           NGH   +++V++N L    Y LL  +  G   ++ SG+     HFVY
Sbjct: 379 NGHYGVTTFVISNTLSSTPYLLLIAIIPGAIAYYLSGLQRQIEHFVY 425


>08_02_0453 -
           17331534-17331656,17332288-17332340,17332612-17332704,
           17332747-17332903,17333246-17333384,17333467-17333529,
           17337990-17338071,17338167-17338245,17338853-17339032,
           17340010-17340272,17340486-17340622,17341662-17341729
          Length = 478

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -2

Query: 587 FSGIHFVYSYDELFDTEGESEQGMLTV*P 501
           ++G+H  Y+Y ++ D +G  E G  TV P
Sbjct: 395 YAGLHHKYAYAQVIDVQGSLEGGCGTVRP 423


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH  F      G S  D AV++V
Sbjct: 507 VIDTPGHESFSNMRSRGMSLCDIAVVVV 534


>08_02_0386 -
           16575636-16575698,16575799-16575858,16575947-16576239,
           16576361-16576517,16576601-16576948,16577047-16577177,
           16577417-16577882,16578425-16579132
          Length = 741

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -2

Query: 626 LLDFLKSGLTVWWFSGIHFVY 564
           +L+    GL VW   GIHFVY
Sbjct: 234 ILEIKTGGLVVWTRGGIHFVY 254


>03_04_0206 - 18493178-18495310
          Length = 710

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = +3

Query: 564 VNKMDSTEPPYSEPRFEEIKKEV 632
           VNK D T   Y +   EEIKKEV
Sbjct: 686 VNKFDGTFEDYKDELLEEIKKEV 708


>09_04_0483 +
           17979566-17980019,17980242-17980321,17980431-17980895,
           17981460-17981597,17982574-17982660,17982781-17982909,
           17983034-17983225,17983393-17983479,17983707-17984378
          Length = 767

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 5/55 (9%)
 Frame = -2

Query: 689 NGHESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGI-----HFVYSYDELFDT 540
           NGH    S+V+AN L    Y  L  +  G   ++ +G+     HF Y    LF T
Sbjct: 552 NGHYGVGSFVIANTLSATPYLALISVAPGAIGYYLTGLQSSIDHFAYFAVVLFTT 606


>04_03_0106 +
           11325172-11325379,11326590-11326640,11326987-11327073,
           11327276-11327373
          Length = 147

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSG 168
           K H+N+V IGHVD G
Sbjct: 104 KRHLNVVFIGHVDPG 118


>03_05_0339 +
           23287620-23287676,23287784-23287849,23287937-23288048,
           23288240-23288368,23288795-23288866,23289245-23289360,
           23289494-23289570,23289788-23290273,23290373-23290688,
           23290769-23290915
          Length = 525

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -1

Query: 492 DTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLA 358
           D    F+G  +  +   I LRG+ +HVLDE    RS++D   VL+
Sbjct: 350 DKLIHFSGV-AMGQACTIVLRGASEHVLDE--AERSLHDALCVLS 391


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,389,926
Number of Sequences: 37544
Number of extensions: 421778
Number of successful extensions: 1308
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 1227
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1284
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1933531792
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -