SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0647 + 23910318-23910694,23911732-23911867,23912067-239122...    33   0.21 
03_06_0088 - 31562596-31563096                                         30   1.1  
10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626...    30   1.5  
01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892...    30   1.5  
01_01_0082 + 625198-625719                                             30   1.5  
03_06_0238 - 32570222-32570330,32570538-32570599,32570658-325708...    29   3.4  
12_02_0761 - 22901121-22901917,22902111-22902707,22904282-229043...    28   4.4  
11_01_0021 - 143576-143932,144434-144667,144988-145066,145138-14...    28   4.4  
07_03_1552 - 27648193-27648307,27648384-27648431,27649140-276492...    28   5.9  
07_03_1207 - 24881074-24881906,24882204-24882285,24882921-24882926     28   5.9  
03_02_0671 + 10315260-10315370,10315984-10316027,10316141-103162...    28   5.9  
09_06_0081 + 20745627-20748144,20748211-20748308                       27   7.7  
09_04_0518 - 18261420-18261953,18262054-18262626,18262736-182629...    27   7.7  
04_04_1551 - 34348110-34348225,34348468-34348606,34348658-343488...    27   7.7  
02_04_0166 - 20508656-20509092,20509282-20509372                       27   7.7  

>01_05_0647 +
           23910318-23910694,23911732-23911867,23912067-23912277,
           23912357-23912724,23913793-23914081,23914173-23914372,
           23914452-23914646
          Length = 591

 Score = 32.7 bits (71), Expect = 0.21
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +3

Query: 360 PAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P PT P  +  P  A  Y  YPY  P+Q       W P+TP
Sbjct: 75  PPPTTP-AYSLPPPAQPYGQYPYPYPSQGQAGAAYWPPSTP 114


>03_06_0088 - 31562596-31563096
          Length = 166

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%)
 Frame = -1

Query: 278 RHRIIW-WYLGWPGGGAFAGL 219
           R R  W W+ GWP GGA AG+
Sbjct: 120 RRRCRWAWHEGWPAGGASAGV 140


>10_08_0683 -
           19860777-19861070,19861677-19861874,19862498-19862659,
           19862763-19862911,19863089-19863236,19863317-19863385,
           19863471-19863719,19863937-19864131,19864444-19864560,
           19864978-19866537
          Length = 1046

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 17/49 (34%), Positives = 22/49 (44%)
 Frame = +3

Query: 291 QHSFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTP 437
           +H + P  S    PAA S P + P   +  G  + HG  G Q  PY  P
Sbjct: 157 RHDYPPPPSPAAVPAASS-PSVLPPSASFPGGGSSHGGGGMQMVPYGPP 204


>01_06_0565 +
           30287253-30287502,30287522-30289010,30289133-30289277,
           30289679-30289729
          Length = 644

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVT-PTQSYDTTIEWVPTTP 482
           PG      P     P   P+P++     TP G  GY   P  T P+ S DT+    PTTP
Sbjct: 143 PGGGCSSSPTPCDAP---PSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTS----PTTP 195



 Score = 29.1 bits (62), Expect = 2.5
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPY-VTPTQSYDTTIEWVPTTP 482
           PG   G  P     P   P+P++     TP G  GY   P    P+ S DT+    PTTP
Sbjct: 169 PGGGGGYSPTPSDTP---PSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTS----PTTP 221



 Score = 28.7 bits (61), Expect = 3.4
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPY-VTPTQSYDTTIEWVPTTP 482
           PG   G  P     P   P+P++     TP G  GY   P    P+ S DT+    PTTP
Sbjct: 195 PGGGGGYTPTPSDAP---PSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTS----PTTP 247


>01_01_0082 + 625198-625719
          Length = 173

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 1/67 (1%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPG-ITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P Y     P  ++YP   TP+   P     P+G  GY   P   PT  Y+ T     T P
Sbjct: 70  PVYYPPPSPPPVAYPPPTTPSTNCPP---PPYGGGGYNPTPSYNPTPGYNPTPSGWFTPP 126

Query: 483 QNASILS 503
              S L+
Sbjct: 127 NMPSYLT 133


>03_06_0238 -
           32570222-32570330,32570538-32570599,32570658-32570883,
           32571165-32571532,32571644-32571743,32571817-32571879,
           32573077-32573123,32573222-32573353
          Length = 368

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 16/65 (24%), Positives = 26/65 (40%)
 Frame = -1

Query: 458 CCIIALGWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSETIPGLE*MLNIIT 279
           C I    +C    + +T C    H+     WC R S    C + +S   P  + +L  + 
Sbjct: 30  CSICLEAFCDNDPSTVTSCKHEYHLQCILEWCQRSSQCPMCWQPISMKDPMSQELLEAVE 89

Query: 278 RHRII 264
           + R I
Sbjct: 90  QERNI 94


>12_02_0761 -
           22901121-22901917,22902111-22902707,22904282-22904358,
           22906543-22907135,22907552-22908118,22908431-22908958,
           22909115-22909432,22910622-22910656,22910986-22911301
          Length = 1275

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 333 AAMSYPGITPAPTAPRGHVTPHGA 404
           +A S P  TP P AP  H+ PHG+
Sbjct: 41  SAPSPPHRTPEPVAPVWHLRPHGS 64


>11_01_0021 -
           143576-143932,144434-144667,144988-145066,145138-145253,
           145717-145861,146048-146465,147206-147869
          Length = 670

 Score = 28.3 bits (60), Expect = 4.4
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +1

Query: 235 PPPGQPKYHQIILCLVIMFN 294
           PPPG P  HQ++LC+ I F+
Sbjct: 71  PPPGPPP-HQLLLCIGIAFH 89


>07_03_1552 -
           27648193-27648307,27648384-27648431,27649140-27649234,
           27649311-27649376,27649721-27649810,27650210-27650437,
           27650572-27650605,27651106-27651611
          Length = 393

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 13/36 (36%), Positives = 16/36 (44%)
 Frame = -2

Query: 409 PNAPCGVTWPRGAVGAGVIPG*DIAAGCCPRLYPGW 302
           P A      PR    A  + G D+   C  RL+PGW
Sbjct: 101 PTAAAAALLPRLRRAAAPLRGTDLWVPCWARLHPGW 136


>07_03_1207 - 24881074-24881906,24882204-24882285,24882921-24882926
          Length = 306

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 16/48 (33%), Positives = 19/48 (39%)
 Frame = +3

Query: 309 GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYD 452
           GY  G   A   Y G+ P P AP  H    G +     PY    Q Y+
Sbjct: 252 GYGGGAFQAPAGYYGVAPPPAAPYDH---QGWYYGNRQPYYHQQQCYE 296


>03_02_0671 +
           10315260-10315370,10315984-10316027,10316141-10316204,
           10316278-10316392,10316504-10316571,10316917-10317014,
           10317543-10317657,10318425-10318641,10319541-10319667,
           10319803-10319857,10319997-10320093,10320748-10320876,
           10320964-10321097,10321660-10321746,10321998-10322069,
           10322320-10322359,10322535-10322779,10323587-10323764,
           10323931-10324136,10324681-10324977
          Length = 832

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%)
 Frame = -1

Query: 455 CIIAL--GWCHIRIALITKCTMWCHMAARCSWCWRDS 351
           C+ AL  G CHIR   +    +W        WCW +S
Sbjct: 401 CLHALWFGNCHIRAIAV----LWIDFVREIRWCWEES 433


>09_06_0081 + 20745627-20748144,20748211-20748308
          Length = 871

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 18/51 (35%), Positives = 22/51 (43%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P   + P  TP P APRG   P    G  S+ Y   + SY   +   PT P
Sbjct: 644 PHLRAPPVATPPPAAPRGWTMP-TTIGRYSFSYGGVSLSY--AMPCAPTAP 691


>09_04_0518 -
           18261420-18261953,18262054-18262626,18262736-18262948,
           18263379-18263510,18263591-18263731,18263899-18264120
          Length = 604

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -1

Query: 140 GKFTTKISKHSKYLFDHG 87
           G FT  +SKH+ +LF HG
Sbjct: 367 GNFTIFLSKHNTFLFGHG 384


>04_04_1551 -
           34348110-34348225,34348468-34348606,34348658-34348896,
           34349042-34349140,34349207-34350188,34350737-34350832,
           34350936-34351064,34351253-34351332,34351420-34351661,
           34351743-34352692
          Length = 1023

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 20/47 (42%), Positives = 22/47 (46%)
 Frame = +3

Query: 297 SFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTP 437
           S  P  +LG    A    G     +APR  VTP GA G  S P VTP
Sbjct: 799 SIAPSLALGNSKCA----GAEGLNSAPR--VTPPGAEGLNSAPRVTP 839


>02_04_0166 - 20508656-20509092,20509282-20509372
          Length = 175

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRGHVT 392
           G   AA+S+P     P APRG VT
Sbjct: 74  GYDAAALSFPEEASRPRAPRGRVT 97


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,233,004
Number of Sequences: 37544
Number of extensions: 345240
Number of successful extensions: 1105
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1032
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1103
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1281410928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -