SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0409 - 20503480-20503678,20504522-20504717,20504805-205048...   149   2e-36
01_01_0745 + 5769150-5769152,5769268-5769375,5769812-5769854,576...   148   2e-36
02_02_0195 + 7676014-7676094,7676111-7676218,7676307-7676349,767...   102   1e-22
05_02_0095 + 6564703-6564705,6564848-6564955,6565153-6565195,656...    86   2e-17
02_02_0196 + 7685933-7685961,7686086-7686284                           49   2e-06
01_07_0141 - 41390483-41391448                                         28   3.4  
03_06_0675 + 35455968-35455970,35456314-35456379,35456513-354565...    27   5.9  
07_01_1047 + 9161305-9161709,9162307-9162444,9162682-9162971,916...    27   7.8  

>06_03_0409 -
           20503480-20503678,20504522-20504717,20504805-20504847,
           20505632-20505739,20505848-20505850
          Length = 182

 Score =  149 bits (360), Expect = 2e-36
 Identities = 81/143 (56%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = +1

Query: 52  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSV 231
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+G S  F +           
Sbjct: 3   SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIR 62

Query: 232 VMKRLLSMYSPRA-KAEEILRX-FKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSI 405
             +++    + R  KA ++L    KV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS 
Sbjct: 63  RNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPST 122

Query: 406 GIYGLDFYVVLCRPGFNVAHRRR 474
           GIYG+DFYVVL R G+ VA RRR
Sbjct: 123 GIYGMDFYVVLERAGYRVARRRR 145


>01_01_0745 +
           5769150-5769152,5769268-5769375,5769812-5769854,
           5769945-5770140,5770836-5771034
          Length = 182

 Score =  148 bits (359), Expect = 2e-36
 Identities = 81/143 (56%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = +1

Query: 52  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSV 231
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+G S  F +           
Sbjct: 3   SEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIR 62

Query: 232 VMKRLLSMYSPRA-KAEEILRX-FKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSI 405
             +++    + R  KA ++L    KV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS 
Sbjct: 63  RNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPST 122

Query: 406 GIYGLDFYVVLCRPGFNVAHRRR 474
           GIYG+DFYVVL R G+ VA RRR
Sbjct: 123 GIYGMDFYVVLERAGYRVARRRR 145


>02_02_0195 +
           7676014-7676094,7676111-7676218,7676307-7676349,
           7676449-7676648
          Length = 143

 Score =  102 bits (245), Expect = 1e-22
 Identities = 59/115 (51%), Positives = 73/115 (63%), Gaps = 2/115 (1%)
 Frame = +1

Query: 52  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSV 231
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+G +  F +           
Sbjct: 29  SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 88

Query: 232 VMKRLLSMYSPRA-KAEEILR-XFKVREYELRRDNFSATGNFGFGIQEHIDLGIK 390
             +++    + R  KA ++L    KV+EYEL R NFS TG FGFGIQEHIDLGIK
Sbjct: 89  RNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK 143


>05_02_0095 +
           6564703-6564705,6564848-6564955,6565153-6565195,
           6565303-6565409,6566310-6566395,6566396-6566594
          Length = 181

 Score = 85.8 bits (203), Expect = 2e-17
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 3/144 (2%)
 Frame = +1

Query: 52  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSV 231
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+G S  F +          +
Sbjct: 3   SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSF-GI 61

Query: 232 VMKRLLSMYSPRAKAEEILRXFKVREYELR-RDNF--SATGNFGFGIQEHIDLGIKYDPS 402
                ++ Y    + E+ ++  +     +R  DN   S T +         +   +YDPS
Sbjct: 62  RRNEKIACY-VTVRGEKAMQLLESGLKIIRIVDNLIPSVTRSTRAKRINLSNQCFRYDPS 120

Query: 403 IGIYGLDFYVVLCRPGFNVAHRRR 474
            GIYG+DFYVVL R G+ VA RRR
Sbjct: 121 TGIYGMDFYVVLERAGYRVARRRR 144



 Score = 52.0 bits (119), Expect = 2e-07
 Identities = 24/31 (77%), Positives = 26/31 (83%)
 Frame = +3

Query: 177 KQPVFSKARYTVRSFGIRRNEKIAVHVQSEG 269
           + PVFSKARYTVRSFGIRRNEKIA +V   G
Sbjct: 45  QSPVFSKARYTVRSFGIRRNEKIACYVTVRG 75


>02_02_0196 + 7685933-7685961,7686086-7686284
          Length = 75

 Score = 48.8 bits (111), Expect = 2e-06
 Identities = 21/28 (75%), Positives = 23/28 (82%)
 Frame = +1

Query: 391 YDPSIGIYGLDFYVVLCRPGFNVAHRRR 474
           YDPS GIYG+DFYVVL R G+ VA RRR
Sbjct: 11  YDPSTGIYGMDFYVVLERAGYRVARRRR 38


>01_07_0141 - 41390483-41391448
          Length = 321

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 106 LNICVGESGDRLTRAAKVLEQLTGNSLYFPRL 201
           + +C G SGD L  A+KV E L  N     RL
Sbjct: 10  VGVCWGMSGDNLPPASKVTEMLRENGFTVVRL 41


>03_06_0675 +
           35455968-35455970,35456314-35456379,35456513-35456565,
           35457142-35457169,35457837-35457911,35458020-35458124,
           35458278-35458367,35458454-35458543
          Length = 169

 Score = 27.5 bits (58), Expect = 5.9
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +1

Query: 148 AAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRLLSMYSPRAKAEEILRXFKVREYEL 318
           A K L + + NS+       Q   L +++ K+ L   S RA+A ++LR   V+ Y++
Sbjct: 58  AEKCLIETSINSIRISMKVKQADELENILAKKFLRFLSMRAEAFQVLRRKPVQGYDI 114


>07_01_1047 +
           9161305-9161709,9162307-9162444,9162682-9162971,
           9163477-9163759,9163839-9163952
          Length = 409

 Score = 27.1 bits (57), Expect = 7.8
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -2

Query: 223 PKDRTVYLALENTGCFL*VAPTP 155
           PKD+ VY  +E T C L V  TP
Sbjct: 126 PKDQAVYQKIEPTSCTLVVRVTP 148


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,449,966
Number of Sequences: 37544
Number of extensions: 251747
Number of successful extensions: 607
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 590
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 601
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 979080328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -