SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20020
         (716 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_07_0196 + 13978647-13979142,13979242-13980542                       30   1.6  
07_03_1519 + 27390204-27390590,27390591-27390809,27392516-273929...    29   2.8  
08_02_0719 + 20388246-20390756,20391159-20391263                       28   6.4  
01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878,589...    28   6.4  

>10_07_0196 + 13978647-13979142,13979242-13980542
          Length = 598

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = +3

Query: 393 SLDSPSFANNAKKQLSAERQRKNLKKILQLKKGRQSSLY-*LQEEISS 533
           S+  PS AN A  ++  E   +NLK++L+L K   S+LY  L+EE S+
Sbjct: 300 SVIEPSDANLAD-EVEGESSPENLKRLLELNKKSMSALYKELEEERSA 346


>07_03_1519 +
           27390204-27390590,27390591-27390809,27392516-27392962,
           27393076-27393274,27393372-27393456,27393566-27393998
          Length = 589

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = +3

Query: 387 LTSLDSPSFANNAKKQLSAERQRKNLKKILQLKKGRQSSLY*LQEEISSDVCKLTISSCI 566
           LT  D        K +L  E+  +  KK+   +K R  +   ++ E++  +C   ++S I
Sbjct: 25  LTEEDRQELERELKHELEEEKMERTKKKLACFQKTRSGAFKKVRSEVNKPICSDDLASLI 84


>08_02_0719 + 20388246-20390756,20391159-20391263
          Length = 871

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +3

Query: 441 AERQRKNLKKILQLKKGRQSSLY*LQEEISSDVCK 545
           A+++ K +K+++ LKK R+  +  L+ E  SD+C+
Sbjct: 680 ADKESKIVKELINLKKLRRLGVLNLRREDGSDLCE 714


>01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878,
            5891941-5892073,5892629-5892732,5892867-5895780,
            5895876-5895965,5896251-5896355,5896633-5896740,
            5896826-5896876
          Length = 1334

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 330  ERLQPIRSFTLKVKRSKRALTSLDSPSFANNA 425
            E LQ IRS T  ++R+  + T+  SP+ AN++
Sbjct: 1274 ELLQQIRSKTFNLRRTNASKTNTSSPTTANSS 1305


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,699,795
Number of Sequences: 37544
Number of extensions: 138220
Number of successful extensions: 399
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 397
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1862792824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -