SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0608 + 16153992-16154960,16158959-16159168,16159252-161595...    30   1.2  
11_04_0236 + 15215386-15216197,15216854-15218888,15219131-152200...    29   3.6  
07_01_0542 + 4002542-4003119,4004347-4004404,4004518-4004835,400...    28   4.8  
07_01_0404 + 3093851-3094051,3094622-3094948,3096685-3096798,309...    28   4.8  
07_01_0400 + 3048607-3048807,3049378-3049704,3051441-3051554,305...    28   4.8  
07_01_0396 + 3016900-3017175,3017926-3018039,3018138-3018350,301...    28   4.8  
02_04_0084 - 19579104-19579230,19580323-19580417,19580578-195807...    28   4.8  
01_03_0289 - 14725832-14726114,14726216-14726298,14726432-147265...    28   4.8  
12_02_1269 + 27462644-27463612                                         28   6.3  
07_01_1129 + 10466943-10467326,10467440-10467574,10467670-104679...    28   6.3  
02_05_0139 - 26194892-26195230                                         28   6.3  
02_01_0312 - 2082614-2082677,2082815-2082945,2083041-2083129,208...    28   6.3  
06_02_0237 + 13341469-13342259,13342839-13343223,13343314-133434...    27   8.4  

>05_03_0608 +
           16153992-16154960,16158959-16159168,16159252-16159512,
           16160153-16160197,16160324-16160410,16160679-16160774
          Length = 555

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = -1

Query: 557 HALVASAFFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSYV 429
           +A VAS F PL    AA  S    TIA  A FP   +S +S+V
Sbjct: 28  YASVASTFDPLLSSAAAAASPPSPTIAAAAAFPLSPSSSSSFV 70


>11_04_0236 + 15215386-15216197,15216854-15218888,15219131-15220017,
            15222420-15226194
          Length = 2502

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 23/68 (33%), Positives = 31/68 (45%)
 Frame = -2

Query: 388  APLWMESLFISCPLRQMILLRGASNIQMSRTNNASNRPLLSSVNFILGQQLEARDEAGKV 209
            AP+ +E L  SC       +RG  N++   T+  SN P    +NF L   +   DE    
Sbjct: 1839 APISIEHL--SCLEEISAKIRGGGNVEFPLTSAISNHPGNPRINFQLVDGVFYGDE--DE 1894

Query: 208  NHATYYMG 185
             HAT  MG
Sbjct: 1895 EHATPTMG 1902


>07_01_0542 +
           4002542-4003119,4004347-4004404,4004518-4004835,
           4005201-4005446,4005550-4005648,4005912-4006097,
           4006204-4006401,4006521-4006596,4006721-4007637
          Length = 891

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -1

Query: 533 FPLALCFAA--GRSGVMRTIARKALFPRPSNSWNSYVPQT*K*NQRETCIGTALD 375
           FP+ LCFAA  G S ++  + ++ L P  S+ +          N  E C+   L+
Sbjct: 524 FPITLCFAASKGDSFLLHQLLKRGLDPNESDHYGRTALHIAASNGNEQCVRLLLE 578


>07_01_0404 +
           3093851-3094051,3094622-3094948,3096685-3096798,
           3096897-3097109,3097975-3098151,3098270-3100091,
           3100107-3100927,3101070-3101390
          Length = 1331

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -1

Query: 395 CIGTALDGVSLHQLPIETDDTIKRSVKHTDESHEQC 288
           C+ +ALD +      IE+D   + S  HT  + E C
Sbjct: 580 CLKSALDYIDSSDTAIESDHDSQHSTAHTSTAPESC 615


>07_01_0400 +
           3048607-3048807,3049378-3049704,3051441-3051554,
           3051653-3051865,3052731-3052907,3053026-3054847,
           3054863-3055683,3055826-3056146
          Length = 1331

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -1

Query: 395 CIGTALDGVSLHQLPIETDDTIKRSVKHTDESHEQC 288
           C+ +ALD +      IE+D   + S  HT  + E C
Sbjct: 580 CLKSALDYIDSSDTAIESDHDSQHSTAHTSTAPESC 615


>07_01_0396 +
           3016900-3017175,3017926-3018039,3018138-3018350,
           3019216-3019392,3019511-3021332,3021348-3022168,
           3022311-3022631
          Length = 1247

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -1

Query: 395 CIGTALDGVSLHQLPIETDDTIKRSVKHTDESHEQC 288
           C+ +ALD +      IE+D   + S  HT  + E C
Sbjct: 496 CLKSALDYIDSSDTAIESDHDSQHSTAHTSTAPESC 531


>02_04_0084 -
           19579104-19579230,19580323-19580417,19580578-19580719,
           19581155-19581189,19581493-19581632,19581678-19581770,
           19584007-19584244
          Length = 289

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = -3

Query: 174 ENSFSDCSSGAGFSGQARVGCE*VGQSRALARMEATRSRVNSHVSR*ARTTRAS 13
           E  F     G+G +GQA  GC+   +  A+A   AT + V +HVS   R T  S
Sbjct: 78  EEEFHGTEKGSGRAGQAPAGCD---EDMAMA---ATYTAVQAHVSIRDRGTAGS 125


>01_03_0289 -
           14725832-14726114,14726216-14726298,14726432-14726545,
           14727830-14728199,14728726-14728856,14728970-14729078,
           14729257-14729378,14729522-14729625,14729849-14729953,
           14730034-14730192,14730336-14730391,14730576-14730627,
           14730725-14731031
          Length = 664

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = -1

Query: 572 MTVCKHALVASAFFPLALCFAAGRSGVMRTIARKALFPRPSNSWN 438
           + V  H L+      LA  F   +  V+R IA   LFP  + +W+
Sbjct: 415 LLVGNHMLLGIELISLATEFLRRKGRVLRGIAHPLLFPNKTKTWS 459


>12_02_1269 + 27462644-27463612
          Length = 322

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = -1

Query: 554 ALVASAFFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSY 432
           ALV +A+ P  L  A GR+  +R   R+     PS  W++Y
Sbjct: 129 ALVENAYLPHVL--AEGRAVTVRNRQRRLFTNNPSADWSAY 167


>07_01_1129 +
           10466943-10467326,10467440-10467574,10467670-10467972,
           10468155-10468247
          Length = 304

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/66 (25%), Positives = 33/66 (50%)
 Frame = -2

Query: 430 FRKLESRINEKLALAPLWMESLFISCPLRQMILLRGASNIQMSRTNNASNRPLLSSVNFI 251
           F KLE    E + ++   + S+  +CP+ + +LL  A   +  R N+AS   +   + + 
Sbjct: 4   FPKLEHLGLEDVVISEGSLHSIIAACPVLECLLLVRAIGFRGLRINSASLTSIGVDILYF 63

Query: 250 LGQQLE 233
             +Q+E
Sbjct: 64  PAEQIE 69


>02_05_0139 - 26194892-26195230
          Length = 112

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -3

Query: 201 PRITWAKRCENSFSDCSSGAGFSGQARVGCE*VGQSRALARMEA 70
           P + W+ RC +S S    G G  G+A  G +   +  A+A M A
Sbjct: 2   PPVLWSPRCRDSVSVVGGGIGAGGEAGGGGQ---KQEAVAAMAA 42


>02_01_0312 -
           2082614-2082677,2082815-2082945,2083041-2083129,
           2083223-2083292,2083429-2083509,2083768-2083821,
           2084864-2085067,2086272-2086366,2086976-2086997,
           2087492-2087585,2087677-2087764,2087874-2087979,
           2088103-2088189,2088261-2088309,2088418-2088521,
           2088605-2088697,2088900-2088974,2089316-2089384,
           2090182-2090250,2090339-2090374,2090471-2090565,
           2090836-2090911,2091067-2091153,2091287-2091355,
           2091654-2091731,2091836-2091925,2092436-2092642,
           2092736-2092879
          Length = 841

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/53 (30%), Positives = 24/53 (45%)
 Frame = +2

Query: 26  VRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRF 184
           ++AH D   F    V  +   AR  PT S  T   P NP+P   +++    +F
Sbjct: 448 IKAHKDIAHFETAYVVKLHRIARLAPTQSVFTFDHP-NPSPNASNQRYTKLKF 499


>06_02_0237 +
           13341469-13342259,13342839-13343223,13343314-13343427,
           13343517-13344011
          Length = 594

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = -1

Query: 176 AKIPFQTAALAPGLVGKPE*AASRWDSHEL-WLAWK 72
           A+ PF  A  APG+V +PE      D H + W  W+
Sbjct: 234 ARPPFNGAVPAPGVVVQPEGKGFHIDDHIVRWANWE 269


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,769,654
Number of Sequences: 37544
Number of extensions: 316674
Number of successful extensions: 945
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 919
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 945
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1388195172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -