SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0610 + 24335153-24337724,24337835-24338256                       29   3.1  
01_06_1434 + 37345522-37345926                                         29   4.0  
01_06_1726 - 39461451-39461791,39462127-39462183,39462527-394626...    28   9.3  

>02_04_0610 + 24335153-24337724,24337835-24338256
          Length = 997

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = -3

Query: 407 EREPSIVRLSMRIKYGASEYRLLCCLIICIKYRPVRTHLRLLT 279
           ER+ ++ RL + I  G     +L CLI  +K  P RT+L LL+
Sbjct: 609 ERKSNLTRLLIPI-VGFLSLTVLICLIYLVKKTPRRTYLSLLS 650


>01_06_1434 + 37345522-37345926
          Length = 134

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 9/15 (60%), Positives = 14/15 (93%)
 Frame = +1

Query: 481 RHILLCVPAGPANDL 525
           RH+ +C+PAGPA+D+
Sbjct: 55  RHMAVCIPAGPASDV 69


>01_06_1726 -
           39461451-39461791,39462127-39462183,39462527-39462674,
           39462775-39463010,39463025-39463059,39463364-39463497
          Length = 316

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = -3

Query: 398 PSIVRLSMRIKYGASE--YRLLCCLIICIKYRPVRT 297
           P +VRL  R+  G+ +  + ++CC  + +K RPV T
Sbjct: 5   PPVVRLPTRVHPGSHKKGFLVVCCPKVQVKTRPVAT 40


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,908,180
Number of Sequences: 37544
Number of extensions: 336640
Number of successful extensions: 609
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 598
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 609
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2039640244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -