SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_03_0150 - 15750329-15750450,15751554-15751644,15751967-157520...    66   2e-11
04_03_0268 - 13663387-13663505,13663935-13664025,13664788-136648...    50   2e-06
04_04_0491 - 25605560-25605684,25605826-25605928,25606026-256075...    31   0.99 
03_05_0187 - 21751374-21752631,21752958-21753399,21753914-21753962     30   1.3  
03_04_0151 - 17729023-17729372,17729441-17730623,17730723-177309...    29   4.0  
03_01_0626 + 4596022-4596462,4596549-4596667,4596745-4596801,459...    28   7.0  
02_05_1248 - 35237036-35237252,35237843-35239491                       28   7.0  

>02_03_0150 -
           15750329-15750450,15751554-15751644,15751967-15752053,
           15752605-15752660,15752812-15752893,15753141-15753217,
           15754028-15754138,15754744-15754906,15755375-15755433,
           15755882-15756011
          Length = 325

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 31/77 (40%), Positives = 46/77 (59%)
 Frame = +3

Query: 342 DIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGV 521
           D    +VW+DLEMTGLD+  D I+EIAC++TD +L     GPD+VIN  +  L+ +    
Sbjct: 141 DYQMPLVWIDLEMTGLDVAKDRILEIACIITDGKLTKQIEGPDLVINQKKDLLDNMDEWC 200

Query: 522 RSNTARQG*QRLALNQT 572
           +++ A  G  +  L  T
Sbjct: 201 KTHHAASGLTQRVLQST 217



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFVSNHV 625
           + WCK  H  +GLT+  L+S  S  +AE  +L FV  HV
Sbjct: 197 DEWCKTHHAASGLTQRVLQSTISEHDAETQVLDFVKKHV 235


>04_03_0268 -
           13663387-13663505,13663935-13664025,13664788-13664874,
           13665849-13665904,13666788-13666841,13667413-13667523,
           13668293-13668419
          Length = 214

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/32 (62%), Positives = 26/32 (81%)
 Frame = +3

Query: 342 DIAQRIVWMDLEMTGLDIENDHIMEIACLVTD 437
           D  + +VW+DLEMTGLDI  D I+EIAC++TD
Sbjct: 66  DYDKPLVWIDLEMTGLDITKDRILEIACIITD 97


>04_04_0491 - 25605560-25605684,25605826-25605928,25606026-25607592,
            25608694-25610198
          Length = 1099

 Score = 30.7 bits (66), Expect = 0.99
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = -1

Query: 510  LFCLKSLQVDL*LYRDLSPLHLAVHLSQDTLFPLCGHFQCQVLSFQDPSIQSSE 349
            L C K L V L   + +SP H ++ L ++ +  + G   C+VL FQ+PS+Q S+
Sbjct: 976  LRCHKKL-VSLRKLQHISPFH-SLRLRKELVQKVSG---CEVLPFQNPSVQDSQ 1024


>03_05_0187 - 21751374-21752631,21752958-21753399,21753914-21753962
          Length = 582

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = -3

Query: 508 ILFKVTSGRFITISGPVATTFSCASVTRHAISIMWSFSMSSP 383
           +L  V SG F  +S  VAT   C   TRHA  + + +S  +P
Sbjct: 257 VLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNMAP 298


>03_04_0151 -
           17729023-17729372,17729441-17730623,17730723-17730953,
           17730975-17731036,17732085-17732157,17737044-17737834,
           17737932-17738004
          Length = 920

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = -3

Query: 493 TSGRFITISGPVATTFSCASVTRHAISIMWSFSMSSPVISRSIHT 359
           TSG   T  G      + AS   H+  ++   S+SSP ISRS+ T
Sbjct: 741 TSGNSST-GGAAKQEATTASTEAHSAKVVLKKSLSSPAISRSLTT 784


>03_01_0626 +
           4596022-4596462,4596549-4596667,4596745-4596801,
           4596921-4597159,4597261-4597379,4597488-4597574,
           4597673-4597720
          Length = 369

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 447 LAVHLSQDTLFPLCGHFQCQVLSFQDPSIQSSELC 343
           + +HLS   LFPL    QCQ+ +F   +     LC
Sbjct: 51  IPLHLSFAFLFPLQRFLQCQMKNFASAAASGVALC 85


>02_05_1248 - 35237036-35237252,35237843-35239491
          Length = 621

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 270 KAITFLTRNLSMSPKIMTKKNTKVDIAQRIVWMDLEMTG 386
           KAI+ L R+L M  +I   ++ + ++A RI W+ L +TG
Sbjct: 428 KAISLLKRSLGMLERIPQAQHMEGNVAARIGWL-LLLTG 465


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,627,734
Number of Sequences: 37544
Number of extensions: 258495
Number of successful extensions: 561
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 561
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1525730988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -