SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0566 - 18583624-18583710,18584445-18584567,18584682-18585044     97   1e-20
02_01_0029 - 176002-176137,176495-176646,177166-177577,178010-17...    97   1e-20
03_06_0712 - 35683814-35684065,35685296-35685466                       27   8.6  

>09_04_0566 - 18583624-18583710,18584445-18584567,18584682-18585044
          Length = 190

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/69 (62%), Positives = 54/69 (78%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +N+I GVTKG++YKMR VYAHFPIN   T  N+ IEIRNFLGEK +R+V M  GVT++ S
Sbjct: 77  QNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRS 136

Query: 432 PKQKDELII 458
            K KDEL++
Sbjct: 137 EKVKDELVL 145



 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 38/77 (49%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV-NPRLLKVEKWF 204
           MK I+A++ ++IP+G+TV V +++VTV+GPRG L RNFKHL +D +++   R L+V+ WF
Sbjct: 1   MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEGGRKLQVDAWF 60

Query: 205 GSKKELAAVRTVCSHVE 255
           G+++ +AA+RT  SHV+
Sbjct: 61  GTRRTMAAIRTAISHVQ 77



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +1

Query: 517 VKNKDIRKFLDGLYVSEKTTVVLD 588
           VKNKDIRKFLDG+YVS+K T+  D
Sbjct: 166 VKNKDIRKFLDGIYVSDKGTITED 189


>02_01_0029 -
           176002-176137,176495-176646,177166-177577,178010-178126,
           178260-178322,178964-179167,180605-180687,182394-182516,
           182987-183328
          Length = 543

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/69 (62%), Positives = 54/69 (78%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +N+I GVTKG++YKMR VYAHFPIN   T  N+ IEIRNFLGEK +R+V M  GVT++ S
Sbjct: 70  QNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRS 129

Query: 432 PKQKDELII 458
            K KDEL++
Sbjct: 130 EKVKDELVL 138



 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 35/70 (50%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +1

Query: 55  VKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV---NPRLLKVEKWFGSKKELA 225
           ++IP G+TVHV +++VTV+GPRG L RNFKHL +D +++     R L+V+ WFG+++ +A
Sbjct: 1   MEIPSGVTVHVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEVEGVRKLQVDAWFGTRRTMA 60

Query: 226 AVRTVCSHVE 255
           A+RT  SHV+
Sbjct: 61  AIRTAISHVQ 70



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +1

Query: 517 VKNKDIRKFLDGLYVSEKTTVVLD 588
           VKNKDIRKFLDG+YVS+K T+  D
Sbjct: 159 VKNKDIRKFLDGIYVSDKGTITED 182


>03_06_0712 - 35683814-35684065,35685296-35685466
          Length = 140

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +1

Query: 124 VLKRNF-KHLAVDIRMVNPRLLKVE 195
           VLKR+F +  AVD+R +NP++ K E
Sbjct: 5   VLKRHFSRKRAVDVRRINPKVPKEE 29


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,369,825
Number of Sequences: 37544
Number of extensions: 338527
Number of successful extensions: 777
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 755
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 775
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1423789920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -