SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...   135   4e-32
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...   122   4e-28
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...    93   2e-19
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...    93   2e-19
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...    93   2e-19
03_01_0548 + 4099386-4099847,4100435-4101316                           87   1e-17
03_01_0547 + 4093196-4093657,4094267-4095148                           87   1e-17
03_01_0544 + 4082528-4082989,4083585-4084466                           87   1e-17
03_01_0543 + 4076981-4077442,4078145-4079026                           87   1e-17
02_04_0462 + 23131433-23132836                                         63   2e-10
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    61   8e-10
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    36   0.033
04_03_0106 + 11325172-11325379,11326590-11326640,11326987-113270...    36   0.043
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    35   0.075
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    35   0.075
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    34   0.13 
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    33   0.17 
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    32   0.40 
06_03_0985 + 26573150-26573375,26573539-26573555                       32   0.53 
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    32   0.53 
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    32   0.53 
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    31   0.93 
05_07_0212 + 28434612-28435931,28436012-28436044,28436557-284366...    31   0.93 
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    31   1.2  
08_02_0321 - 15761468-15761512,15761573-15761673,15761854-157619...    29   2.8  
05_03_0645 + 16529635-16529794,16530188-16530312,16531100-165311...    29   2.8  
12_02_0394 - 18563068-18563108,18563170-18563455,18565606-185656...    29   3.7  
02_02_0474 + 10738476-10738797,10739568-10739677,10739891-107400...    29   4.9  
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     29   4.9  
12_02_0715 - 22453747-22453935,22454347-22454457,22454514-224545...    28   8.6  
12_02_0386 + 18429675-18430679,18431001-18431111,18431139-184311...    28   8.6  
09_02_0539 - 10408398-10409552                                         28   8.6  
08_02_1107 + 24357113-24357288,24357530-24357590,24358736-24359575     28   8.6  
08_01_0842 - 8252232-8253155                                           28   8.6  
04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506...    28   8.6  
04_01_0103 + 1082077-1082167,1083037-1085477                           28   8.6  
03_05_0370 + 23541188-23542537                                         28   8.6  
02_04_0017 + 18937774-18937864,18938505-18940945                       28   8.6  

>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score =  135 bits (326), Expect = 4e-32
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 4/86 (4%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAP----GHKSFVPNMIGGAAQA 431
           WY+++ +DTN+EER KGKTVEVGRA+FETE   FTILDAP    GHKS+VPNMI GA+QA
Sbjct: 41  WYMAYIMDTNEEERLKGKTVEVGRAHFETETTRFTILDAPVKMKGHKSYVPNMISGASQA 100

Query: 432 DLAVLVISARKGEFETGFDRGGQTRD 509
           D+ VLVISARKGEFETG+++GGQTR+
Sbjct: 101 DIGVLVISARKGEFETGYEKGGQTRE 126



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 22/45 (48%), Positives = 35/45 (77%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKN 643
           H +LAKT GV  L+ ++NKMD+PTV W ++RY+E   K++P+L++
Sbjct: 127 HVLLAKTLGVAKLIVVINKMDEPTVKWSKERYDEIESKMVPFLRS 171



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 154 DAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKS 255
           DAGKST GGQI+ L+G VD RT++KYE+EA++KS
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKS 37


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score =  122 bits (293), Expect = 4e-28
 Identities = 56/75 (74%), Positives = 65/75 (86%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D + +   KGKTVEVGRA+FETE   FTILDAPGHKS+VPNMI GA+QAD+ VLVISARK
Sbjct: 7   DLSIKMEPKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARK 66

Query: 465 GEFETGFDRGGQTRD 509
           GEFETG++RGGQTR+
Sbjct: 67  GEFETGYERGGQTRE 81



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 23/45 (51%), Positives = 34/45 (75%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKN 643
           H +LAKT GV  LV ++NKMD+ TV W ++RY+E   K++P+LK+
Sbjct: 82  HVLLAKTLGVSKLVVVINKMDESTVGWSKERYDEIEGKMVPFLKS 126


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 42/78 (53%), Positives = 55/78 (70%), Gaps = 1/78 (1%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +WA+D + EER++G T+ V  AY ET+K    +LD+PGHK FVPNMI GA QAD A+LV+
Sbjct: 297 AWAMDESSEERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVV 356

Query: 453 SARKGEFETGFD-RGGQT 503
            A  G FE G D  GG++
Sbjct: 357 DACTGSFEAGMDGEGGKS 374



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 22/64 (34%), Positives = 42/64 (65%)
 Frame = +1

Query: 127 VNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNE 306
           +N+  +GHVD+GKST+ G+++ L G + K+ + K E+EA+EK +  G++   W   + +E
Sbjct: 248 LNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGK--GSFAYAWAMDESSE 305

Query: 307 TKAK 318
            + +
Sbjct: 306 ERER 309



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKN 643
           HA L ++ GV+ L+  VNKMD   + + ++R+   + ++  +L++
Sbjct: 381 HAQLIRSFGVEQLIVAVNKMD--AIGYSKERFEFIKVQLGSFLRS 423


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 42/78 (53%), Positives = 55/78 (70%), Gaps = 1/78 (1%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +WA+D + EER++G T+ V  AY ET+K    +LD+PGHK FVPNMI GA QAD A+LV+
Sbjct: 297 AWAMDESSEERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVV 356

Query: 453 SARKGEFETGFD-RGGQT 503
            A  G FE G D  GG++
Sbjct: 357 DACTGSFEAGMDGEGGKS 374



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 22/64 (34%), Positives = 42/64 (65%)
 Frame = +1

Query: 127 VNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNE 306
           +N+  +GHVD+GKST+ G+++ L G + K+ + K E+EA+EK +  G++   W   + +E
Sbjct: 248 LNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGK--GSFAYAWAMDESSE 305

Query: 307 TKAK 318
            + +
Sbjct: 306 ERER 309



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 13/45 (28%), Positives = 28/45 (62%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLKN 643
           HA L ++ GV+ L+  VNKMD   + + ++R+   + ++  +L++
Sbjct: 381 HAQLIRSFGVEQLIVAVNKMD--AIGYSKERFEFIKVQLGSFLRS 423


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +WA+D + +ER++G T+ VG AYF+T+  H  +LD+PGHK FVPNMI GA Q+D A+LVI
Sbjct: 284 AWAMDESADERERGITMTVGVAYFDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVI 343

Query: 453 SARKGEFETGFDRG--GQTRD 509
            A  G FE G      GQT++
Sbjct: 344 DASIGSFEAGMGINGIGQTKE 364


>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLK 179


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLK 179


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLK 179


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLK 179


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 28/62 (45%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      +ETE +H+  +D PGH  +V NMI GAAQ D A+LV+S  
Sbjct: 108 IDAAPEERARGITINTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGA 167

Query: 462 KG 467
            G
Sbjct: 168 DG 169



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVN+  IGHVD GK+T+   +  +   V     +KY+
Sbjct: 68  KPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYD 106


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 27/62 (43%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET K+H+  +D PGH  +V NMI GAAQ D  +LV+SA 
Sbjct: 105 IDKAPEEKARGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAP 164

Query: 462 KG 467
            G
Sbjct: 165 DG 166



 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDK 213
           K HVNV  IGHVD GK+T+   I  +     K
Sbjct: 65  KPHVNVGTIGHVDHGKTTLTAAITKVLAEAGK 96


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           N   I H+D GKST+  +++ LTG V KR +++
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKREMKQ 111



 Score = 31.9 bits (69), Expect = 0.53
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA---YFETEKKH-FTILDAPGHKSFVPNMIGGAAQADLAVLV 449
           LD    ER++G T+++  A   Y   ++ +   ++D PGH  F   +    A  + A+LV
Sbjct: 114 LDNMDLERERGITIKLQAARMRYIMNDEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLV 173

Query: 450 ISARKG 467
           + A +G
Sbjct: 174 VDASQG 179


>04_03_0106 +
           11325172-11325379,11326590-11326640,11326987-11327073,
           11327276-11327373
          Length = 147

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = +1

Query: 97  VEDTRSKKEHVNVVFIGHVDAG 162
           VE+ +  K H+NVVFIGHVD G
Sbjct: 97  VEEEKETKRHLNVVFIGHVDPG 118


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GAA  D+ VLV++A  G
Sbjct: 248 TFLDTPGHAAFSAMRARGAAVTDIVVLVVAADDG 281


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 303 RDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           R++ K ++ G A        F ++D PGH+SF      G++  D+A+LV+   +G
Sbjct: 470 RERTKELKAGAAL---HVPGFLVIDTPGHQSFSNLRTRGSSLCDIAILVVDIMRG 521


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+A +
Sbjct: 148 RHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANE 183



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           +L+K    K  P   +  S++  +N+  IGHV  GKST+   I  +  +  K  LE+
Sbjct: 38  DLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELER 94


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+   ER+KG T++    Y         I+D PGH  F   +       D A+LV+ + 
Sbjct: 111 MDSMDLEREKGITIQSAATYCTWNGYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSV 170

Query: 462 KG 467
            G
Sbjct: 171 GG 172


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 32.3 bits (70), Expect = 0.40
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMVDK 213
           N   I HVD GKST+  +++ LTG + K
Sbjct: 59  NFSIIAHVDHGKSTLADRLLELTGTIKK 86


>06_03_0985 + 26573150-26573375,26573539-26573555
          Length = 80

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +1

Query: 112 SKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQ 291
           S+   ++   I HV AG   +G  +  L G+ D R  E+ E+  RE+ E        W Q
Sbjct: 11  SEMRRIDYGSIWHVIAGNIGLGVTLFGLKGLHDMRMEEREEKWNREREERLEAARKEWIQ 70


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH +F   M      AD AVLV+ A +G
Sbjct: 223 IMDTPGHVNFSDEMTAALRIADGAVLVVDAAEG 255


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +3

Query: 279 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISA 458
           A+D+   ER++G T+         ++    ++D PGH  F   +       + AVLV+ A
Sbjct: 97  AMDSISLERERGITIASKVTSVSWKENELNMVDTPGHADFGGEVERVVGMVEGAVLVVDA 156

Query: 459 RKG 467
            +G
Sbjct: 157 GEG 159


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 11/71 (15%)
 Frame = +3

Query: 288 TNQEERDKGK-TVEVGRAYFETE------KKH----FTILDAPGHKSFVPNMIGGAAQAD 434
           TN ++ D G  T ++G  Y   E      K H      ++D PGH+SF      G +  D
Sbjct: 469 TNVQKGDAGGITQQIGATYVPVEYVKERAKPHKVPGLLVIDTPGHESFSNMRSRGMSLCD 528

Query: 435 LAVLVISARKG 467
           +AV+V+    G
Sbjct: 529 IAVVVVDIMHG 539


>05_07_0212 +
           28434612-28435931,28436012-28436044,28436557-28436670,
           28436767-28437102,28437221-28437283,28437364-28437519,
           28437650-28437715,28439074-28439310,28439403-28439678,
           28440060-28440248,28440459-28440620
          Length = 983

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +3

Query: 372 LDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           LD PGH++F      GA   D+ ++V+SA  G
Sbjct: 483 LDTPGHEAFGAMRARGARVTDICIIVVSADDG 514


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           ++D PGH+SF      G++  D+A+LV+    G
Sbjct: 766 VIDTPGHESFSNLRSRGSSLCDIAILVVDIMHG 798


>08_02_0321 -
           15761468-15761512,15761573-15761673,15761854-15761950,
           15762671-15762742,15762838-15762960,15763047-15763129,
           15763269-15763410,15763496-15763654
          Length = 273

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -3

Query: 149 CPINTTFTCSFLLRVSSTRGGFFFGIFFVNSPSSLGFV 36
           C   T+ TC+F L    TR G FF ++F  + S L FV
Sbjct: 27  CASATSNTCAFSLAEHLTREGMFFDLYF-RTQSYLRFV 63


>05_03_0645 +
           16529635-16529794,16530188-16530312,16531100-16531173,
           16531961-16532006,16532638-16532730,16534429-16535886
          Length = 651

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
 Frame = -1

Query: 571 IHLVYK-CYQMFHSSCFS*HRMSRVCPPLSKPVSNSPLRAEMTNTARS 431
           +HLV   C  MFH  C      SRV P L  P  ++P+        RS
Sbjct: 391 LHLVLPVCSHMFHQRCLVAWLRSRVTPLLCCPECHAPITTRCRTDKRS 438


>12_02_0394 -
           18563068-18563108,18563170-18563455,18565606-18565664,
           18567524-18567611
          Length = 157

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 24/87 (27%), Positives = 39/87 (44%)
 Frame = +1

Query: 25  QVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGM 204
           Q+  T+P+  G L K++ K  PP V  TR+         +G V+ G+  +GG + SL  M
Sbjct: 3   QIPRTSPHYYGMLPKQMSKGHPPMV--TRA---------VGGVEKGE--VGGNVRSLQVM 49

Query: 205 VDKRTLEKYEREAREKSENHGTYHGHW 285
             K    K  ++ +    +   Y   W
Sbjct: 50  HSKELQAKIRKQLQRVELSPSLYDTAW 76


>02_02_0474 +
           10738476-10738797,10739568-10739677,10739891-10740094,
           10740400-10740576,10740659-10740811,10741535-10741624,
           10741939-10742049,10742169-10742285,10742881-10743032,
           10743116-10743200,10743597-10743691,10744211-10744376,
           10744459-10744654,10745662-10745795
          Length = 703

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSF 398
           +D+N  ER++G T+         +     I+D PGH  F
Sbjct: 157 MDSNDLERERGITILSKNTSITYKGTKINIIDTPGHSDF 195


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK+++ N+  I HVD GKST+   +++  G++
Sbjct: 15  KKDNIRNMSVIAHVDHGKSTLTDSLVAAAGII 46


>12_02_0715 -
           22453747-22453935,22454347-22454457,22454514-22454572,
           22454893-22455067,22455255-22455307,22455670-22455739,
           22457044-22457218,22457639-22457703,22458196-22460826
          Length = 1175

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = +3

Query: 321 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLA 440
           VE G +YF++    + I   P H + V ++ G A Q D A
Sbjct: 664 VEEGLSYFKSMSDEYGIRPRPDHYACVIDIFGRAGQLDRA 703


>12_02_0386 +
           18429675-18430679,18431001-18431111,18431139-18431195,
           18431552-18431589,18431688-18431733,18431811-18431849
          Length = 431

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +3

Query: 321 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGA 422
           VE G+ YFE  K  + +  +P H + V ++ G A
Sbjct: 220 VEYGKNYFELMKTTYAVQQSPDHYACVVDLYGRA 253


>09_02_0539 - 10408398-10409552
          Length = 384

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 582 TVGSSILFTSATKCFTPAVLANIACHE 502
           T+G    F ++TKCF  +V A  AC E
Sbjct: 312 TLGDRAFFVNSTKCFGASVSAKEACLE 338


>08_02_1107 + 24357113-24357288,24357530-24357590,24358736-24359575
          Length = 358

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
 Frame = -3

Query: 155 STCPI-NTTFTCSFLLRVSSTRGGFFFGIFFVNSP 54
           S CP+ N   TC+ LL V  T  GF  G F +++P
Sbjct: 159 SPCPLANIVGTCNGLLCVVGTGAGFTTGGFVLSNP 193


>08_01_0842 - 8252232-8253155
          Length = 307

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +3

Query: 294 QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISA 458
           QE++      E+        +K  +ILD  GH  F    + GAA A+ A    SA
Sbjct: 56  QEKQSSPPLGEIADQAVSRFRKVISILDRTGHARFRRGPVVGAAAAEAAAAAASA 110


>04_04_0964 -
           29749624-29749649,29749742-29749945,29750036-29750634,
           29750742-29750826,29750914-29751562,29751568-29751643,
           29753891-29753957,29754097-29754998,29756579-29756790
          Length = 939

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/55 (23%), Positives = 28/55 (50%)
 Frame = -3

Query: 446 QYSEVSLSSPTNHVWNKTFVSRGIKNCKMLLFSLKISSSNFYCFAFVSFFLICVQ 282
           ++ +V+     N      F    +K   +L F L++  ++F+ F  VS+F +C++
Sbjct: 620 EFLDVAADVDMNSNLPTDFARPTLKEKFLLNFKLELEYNSFFAFDHVSYFRMCLE 674


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   +++  G++
Sbjct: 15  KKNNIRNMSVIAHVDHGKSTLTDSLVAAAGII 46


>03_05_0370 + 23541188-23542537
          Length = 449

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = +3

Query: 321 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLA 440
           V+ GRA F   K+ + I   P H +   +++G A Q D A
Sbjct: 316 VDEGRAMFHLMKRQYGINPGPEHYACFIDLLGRAGQIDEA 355


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   +++  G++
Sbjct: 15  KKNNIRNMSVIAHVDHGKSTLTDSLVAAAGII 46


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,009,909
Number of Sequences: 37544
Number of extensions: 340588
Number of successful extensions: 1113
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 1046
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1112
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1886372480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -