SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1341 + 29458085-29458198,29458448-29458526,29458923-294589...   150   9e-37
05_01_0022 + 154399-154428,154528-154716,155469-155619,155724-15...   148   4e-36
09_06_0359 + 22508900-22509439                                        146   1e-35
02_01_0160 + 1116160-1116678                                          143   1e-34
06_01_0798 - 5944815-5944888,5945084-5945243,5945319-5945356,594...   128   6e-30
02_05_0830 + 32066419-32066676,32067779-32067820,32068375-320688...   127   1e-29
06_03_1340 + 29455210-29455290,29455493-29455571,29455767-294558...   126   1e-29
10_01_0309 + 3417602-3418147                                          120   9e-28
01_02_0015 + 10191793-10191957,10192085-10192229,10192331-101924...   114   6e-26
08_02_1578 - 27992848-27992893,27993431-27993515,27994107-279942...   110   1e-24
08_02_1563 + 27886202-27886446,27886533-27886618,27886942-278870...   109   2e-24
02_01_0782 + 5827364-5827441,5827733-5827787,5828761-5828849,582...   109   2e-24
06_01_0214 + 1634171-1634173,1634263-1634742                           93   2e-19
03_02_0048 - 5265595-5265783,5265882-5265992,5266259-5266547,526...    88   7e-18
09_06_0098 + 20850535-20850612,20851258-20851333,20851474-208515...    84   9e-17
01_05_0478 - 22587881-22588021,22588126-22588266,22588436-225886...    71   1e-12
03_06_0417 - 33782577-33782687,33782996-33783052,33783110-337832...    69   5e-12
06_03_1076 + 27409107-27409204,27409731-27409835,27409915-274100...    66   2e-11
07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759,420...    61   1e-09
06_03_1075 + 27399279-27399376,27399449-27399555,27400791-274008...    58   7e-09
07_03_0359 - 17201711-17201803,17202185-17202332,17202437-172025...    48   6e-06
02_01_0086 + 613113-613532                                             45   5e-05
11_06_0322 + 22358505-22358642,22358690-22358791,22359444-223595...    38   0.008
10_01_0310 + 3425099-3425218                                           37   0.018
08_02_0053 + 11721658-11721689,11721960-11722710                       37   0.018
01_01_0077 - 585670-585787,585921-586687                               37   0.018
03_05_0695 - 26851370-26851495,26852949-26853398                       31   1.2  
12_02_1032 + 25542420-25542573,25543511-25543577,25543816-255439...    30   2.1  
11_01_0361 + 2772193-2772334,2773457-2773587,2773872-2773985,277...    29   3.6  
07_03_1767 + 29338867-29338912,29339261-29339325,29339571-293396...    29   3.6  
05_02_0115 - 6758540-6758771,6759417-6759524,6759670-6759840,675...    29   3.6  
02_03_0180 - 16031366-16031445,16031950-16032022,16032148-160321...    29   4.8  
06_01_0719 + 5239238-5239635,5239735-5239945,5240379-5240454,524...    28   6.4  
03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-11...    28   6.4  

>06_03_1341 +
           29458085-29458198,29458448-29458526,29458923-29458970,
           29459064-29459087,29459554-29459736,29459845-29459920,
           29460020-29460158
          Length = 220

 Score =  150 bits (364), Expect = 9e-37
 Identities = 70/107 (65%), Positives = 80/107 (74%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGDFT  +G GG+SIYG KF DENF +KHTGPG+LSMANAG 
Sbjct: 100 LHFKGSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGR 159

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           DTNGSQFFITTV TSWLDG+HVVFG V+ GM+VV +IE      G P
Sbjct: 160 DTNGSQFFITTVTTSWLDGKHVVFGKVLSGMDVVYKIEAEGQQSGSP 206



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRVI 250
           +V+FDV +D  P G++V+ L     PKT ENFRALCTGEKG G       +KGS FHR+I
Sbjct: 52  KVYFDVEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRII 111

Query: 251 P 253
           P
Sbjct: 112 P 112


>05_01_0022 +
           154399-154428,154528-154716,155469-155619,155724-155812,
           156391-156445,156533-156618,156705-156857
          Length = 250

 Score =  148 bits (359), Expect = 4e-36
 Identities = 70/108 (64%), Positives = 81/108 (75%), Gaps = 1/108 (0%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDF   NGTGGKSIYG  F+DENF L HTGPGV+SMANAG +TN
Sbjct: 131 KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMANAGPNTN 190

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
           GSQFFI TVKT WLDGRHVVFG V+EGM++VK IE+     G RP ++
Sbjct: 191 GSQFFICTVKTPWLDGRHVVFGQVIEGMDIVKMIESQETDRGDRPKKK 238



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 3/56 (5%)
 Frame = +2

Query: 92  RVFFDVTVDDAP---LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FD+++ +     +G++VI L  D  P+T ENFRALCTGEKGFGYKGS FHRVI
Sbjct: 84  KVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRALCTGEKGFGYKGSSFHRVI 139


>09_06_0359 + 22508900-22509439
          Length = 179

 Score =  146 bits (355), Expect = 1e-35
 Identities = 66/105 (62%), Positives = 82/105 (78%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P+FM QGGDFT  NGTGG+SIYG++F DENF L+HTGPGVLSMANAG 
Sbjct: 55  LHYKGSAFHRIIPNFMCQGGDFTRGNGTGGESIYGDRFADENFKLRHTGPGVLSMANAGP 114

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           +TNGSQFFI T +T+WLDG+HVVFG VV+G  VV+++E + +  G
Sbjct: 115 NTNGSQFFICTTRTTWLDGKHVVFGKVVDGYTVVEKMEQVGSGSG 159



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 7/69 (10%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           P+VFFD+ +  A  G++V+EL +D  PKT ENFR LCTGEKG G       YKGS FHR+
Sbjct: 6   PKVFFDILIGKARAGRVVMELFADTVPKTAENFRCLCTGEKGLGASGKPLHYKGSAFHRI 65

Query: 248 IPISCCKEG 274
           IP   C+ G
Sbjct: 66  IPNFMCQGG 74



 Score = 31.9 bits (69), Expect = 0.52
 Identities = 12/20 (60%), Positives = 18/20 (90%)
 Frame = +3

Query: 513 GSHSGKTSKRIVIKDCGQIA 572
           GS SG T++R++I+DCGQ+A
Sbjct: 155 GSGSGGTAERVLIEDCGQLA 174


>02_01_0160 + 1116160-1116678
          Length = 172

 Score =  143 bits (347), Expect = 1e-34
 Identities = 68/105 (64%), Positives = 76/105 (72%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM QGGDFT  NGTGG+SIYG KF DE F  KH  PG+LSMANAG 
Sbjct: 53  LHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSPGILSMANAGP 112

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           +TNGSQFFI TV  SWLDG+HVVFG VVEGM+VVK IE + +  G
Sbjct: 113 NTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGG 157



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 43/72 (59%), Positives = 49/72 (68%), Gaps = 7/72 (9%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           MS  RVFFD+TV  AP G+IV+EL +   P+T ENFRALCTGEKG G       YKGS F
Sbjct: 1   MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEKGVGKSGKPLHYKGSTF 60

Query: 239 HRVIPISCCKEG 274
           HRVIP   C+ G
Sbjct: 61  HRVIPEFMCQGG 72



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +3

Query: 513 GSHSGKTSKRIVIKDCGQIA 572
           GS  G T+K +VI DCGQ++
Sbjct: 153 GSRGGSTAKPVVIADCGQLS 172


>06_01_0798 -
           5944815-5944888,5945084-5945243,5945319-5945356,
           5945438-5945513,5946114-5946218,5947486-5947986,
           5948638-5948710,5949550-5949593,5949938-5950174
          Length = 435

 Score =  128 bits (308), Expect = 6e-30
 Identities = 60/96 (62%), Positives = 73/96 (76%)
 Frame = +1

Query: 220 LQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADT 399
           +QG  F      FM+QGGD T  +GTGG+SIYG KFEDENF LKH   G+LSMAN+G +T
Sbjct: 117 VQGSCFHRVIKGFMVQGGDITAGDGTGGESIYGLKFEDENFVLKHERKGMLSMANSGPNT 176

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NGSQFFITT +T  LDG+HVVFG V++GM VV+ +E
Sbjct: 177 NGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSVE 212



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 27/44 (61%), Positives = 32/44 (72%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG 220
           PR F DV++     G+IVIEL + V P+T ENFRALCTGEKG G
Sbjct: 26  PRCFMDVSIGGEIEGRIVIELYASVVPRTAENFRALCTGEKGVG 69


>02_05_0830 +
           32066419-32066676,32067779-32067820,32068375-32068875,
           32069048-32069135,32069251-32069303,32069499-32069603,
           32069886-32069961,32070038-32070075,32070162-32070242,
           32070353-32070364
          Length = 417

 Score =  127 bits (306), Expect = 1e-29
 Identities = 58/84 (69%), Positives = 68/84 (80%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGD T  +GTGG+SIYG  FEDENF LKH   G+LSMANAG DTNGSQFFITT +T
Sbjct: 111 FMVQGGDITAGDGTGGESIYGLNFEDENFVLKHERKGMLSMANAGPDTNGSQFFITTTRT 170

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
             LDG+HVVFG V++GM VV+ +E
Sbjct: 171 PHLDGKHVVFGRVIKGMGVVRSME 194



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG 214
           PR + DV++     G+IV+EL + V P+T ENFRALCTGEKG
Sbjct: 33  PRCYLDVSIGGDMEGRIVVELYASVAPRTAENFRALCTGEKG 74


>06_03_1340 +
           29455210-29455290,29455493-29455571,29455767-29455814,
           29455908-29455931,29456433-29456615,29456730-29456805,
           29456937-29457072
          Length = 208

 Score =  126 bits (305), Expect = 1e-29
 Identities = 61/107 (57%), Positives = 73/107 (68%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGD  + NGTG  SIYG  F DENF + H+ PG+LSMAN   
Sbjct: 89  LSYKGTPFHRIIPGFMIQGGDTVSGNGTGCDSIYGGMFPDENFKINHSAPGLLSMANYAK 148

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           DTNGSQFFITTVK + LDG+HVVFG V+ GM+VV +IE   +  G P
Sbjct: 149 DTNGSQFFITTVKLTRLDGKHVVFGKVLSGMDVVYKIEAEGSQSGTP 195



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRVI 250
           +VFFD+T++  P G+IV+ L  +  PKT ENFRA+CTGEKG G       YKG+ FHR+I
Sbjct: 41  KVFFDITINGKPAGRIVMGLFGNTVPKTAENFRAICTGEKGLGKSGKPLSYKGTPFHRII 100

Query: 251 P 253
           P
Sbjct: 101 P 101


>10_01_0309 + 3417602-3418147
          Length = 181

 Score =  120 bits (290), Expect = 9e-28
 Identities = 60/115 (52%), Positives = 71/115 (61%), Gaps = 3/115 (2%)
 Frame = +1

Query: 205 RERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIY---GNKFEDENFTLKHTGPGVLS 375
           + RL  +G  F    P FM QGGD T  NGTGG+S        F DE F +KH GPGV+S
Sbjct: 57  KSRLHYKGSAFHRVVPGFMCQGGDITAGNGTGGESALDGAARHFPDEGFAVKHDGPGVVS 116

Query: 376 MANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
           MANAG +TNGSQFFIT  K  WLDGRHV FG VV GM  V+ I+      G+ ++
Sbjct: 117 MANAGPNTNGSQFFITVDKAPWLDGRHVAFGRVVAGMGAVRAIDRTGTWSGKTVK 171



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 7/71 (9%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG-------FGYKGSIFH 241
           S PRVF D+ +    +G++VIEL +D  P T ENFR LCTGE+          YKGS FH
Sbjct: 9   SNPRVFLDIAIGGEWVGRVVIELLADKVPDTAENFRRLCTGERAGRSGKSRLHYKGSAFH 68

Query: 242 RVIPISCCKEG 274
           RV+P   C+ G
Sbjct: 69  RVVPGFMCQGG 79


>01_02_0015 +
           10191793-10191957,10192085-10192229,10192331-10192419,
           10193009-10193063,10193607-10193692,10194006-10194065
          Length = 199

 Score =  114 bits (275), Expect = 6e-26
 Identities = 53/72 (73%), Positives = 58/72 (80%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDF N+NGTGG+SIYG  F+DENFTLKHTGPGVLSMANAG DTN
Sbjct: 111 KGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGPGVLSMANAGPDTN 170

Query: 403 GSQFFITTVKTS 438
           GSQFFI TVK S
Sbjct: 171 GSQFFICTVKFS 182



 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 33/53 (62%), Positives = 40/53 (75%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           + FFDV V   P G+IVI L  +V PKT +NFRALCTG+KG+GYKG  FHR+I
Sbjct: 67  KCFFDVEVGGEPAGRIVIGLFGEVVPKTVDNFRALCTGDKGYGYKGCSFHRII 119


>08_02_1578 -
           27992848-27992893,27993431-27993515,27994107-27994240,
           27994579-27994640,27994736-27994831,27994952-27995023
          Length = 164

 Score =  110 bits (264), Expect = 1e-24
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 3/107 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD T   G GG+SIYG KFEDE    LKHTG G+LSMANAG +TNGSQFFIT   
Sbjct: 58  FIVQGGDPTG-TGRGGESIYGAKFEDEIRPELKHTGAGILSMANAGPNTNGSQFFITLAP 116

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE-SLSKTVVR 567
              LDG+H +FG V +GME+VK++ ++      RP+ E  + +TVV+
Sbjct: 117 CQSLDGKHTIFGRVSKGMEIVKRLGSVQTDKSDRPIHEVKILRTVVK 163



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 26/81 (32%), Positives = 37/81 (45%)
 Frame = +2

Query: 104 DVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSP 283
           +VT++ + +G   IE+     PKTC NF  L    +G+ Y   IFHR+I      +G  P
Sbjct: 11  EVTLETS-MGAFTIEMYYKHAPKTCRNFLEL--SRRGY-YDNVIFHRIIK-DFIVQGGDP 65

Query: 284 TITALGESPSTAISLKTRISP 346
           T T  G         +  I P
Sbjct: 66  TGTGRGGESIYGAKFEDEIRP 86


>08_02_1563 +
           27886202-27886446,27886533-27886618,27886942-27887030,
           27887193-27887432,27887527-27887648,27888103-27888178,
           27888276-27888383,27888465-27888641,27888959-27889176,
           27889313-27889445,27889584-27889807,27890052-27890205,
           27890297-27890380
          Length = 651

 Score =  109 bits (263), Expect = 2e-24
 Identities = 54/85 (63%), Positives = 67/85 (78%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    +GTGG+SI+G +FEDE + +L+H  P  LSMANAG +TNGSQFFITTV 
Sbjct: 544 FMIQTGDPLG-DGTGGQSIWGREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVA 602

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
           T WLD +H VFG VV+GM+VV+QIE
Sbjct: 603 TPWLDNKHTVFGRVVKGMDVVQQIE 627



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 24/60 (40%), Positives = 28/60 (46%)
 Frame = +2

Query: 71  TGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           T   SLP    D  V    +G I + L  +  PKT ENF   C    G+ Y   IFHRVI
Sbjct: 489 TATTSLP----DNLVMHTSMGDIHLRLYPEECPKTVENFTTHC--RNGY-YDNLIFHRVI 541


>02_01_0782 +
           5827364-5827441,5827733-5827787,5828761-5828849,
           5829167-5829191,5829645-5829683,5830316-5830433,
           5830857-5831023,5831155-5831518,5831589-5831701,
           5832185-5832310,5832436-5833339,5833694-5834036
          Length = 806

 Score =  109 bits (263), Expect = 2e-24
 Identities = 51/84 (60%), Positives = 64/84 (76%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM QGGDF+N +G+GG+SIYG  FEDENF L+H   G+LSMANAG +TNGSQFFIT    
Sbjct: 71  FMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNGSQFFITFKHN 130

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
           S LD +  VFG ++ G +V+K+IE
Sbjct: 131 SRLDRKSTVFGKLILGNDVLKRIE 154



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 36/66 (54%), Positives = 43/66 (65%), Gaps = 8/66 (12%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P VF DV++ D P  ++V EL +DV P+T ENFRALCTGE G G        YKGS
Sbjct: 3   KKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGS 62

Query: 233 IFHRVI 250
           +FHRVI
Sbjct: 63  LFHRVI 68


>06_01_0214 + 1634171-1634173,1634263-1634742
          Length = 160

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG SI+G KF DE   +LKH   GV+SMAN+G +TNGSQFFIT  K
Sbjct: 49  FMIQGGDPTG-TGKGGTSIWGKKFADEFRESLKHNARGVMSMANSGPNTNGSQFFITYAK 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
              L+G + VF  V+ G EV+  +E      G RPL E
Sbjct: 108 QPHLNGHYTVFAKVIHGFEVLDLMEKAQTGPGDRPLAE 145



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 26/58 (44%), Positives = 31/58 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG I  E+  D  P+T ENF ALC    G+ Y G+IFHR I      +G  PT T  G
Sbjct: 9   LGDIKCEVFCDQAPRTAENFLALCA--SGY-YDGTIFHRNIK-GFMIQGGDPTGTGKG 62


>03_02_0048 -
           5265595-5265783,5265882-5265992,5266259-5266547,
           5266647-5266903,5266995-5267356,5267447-5267522,
           5267618-5267707,5267800-5267891,5267995-5268098,
           5268191-5268253,5268609-5268736
          Length = 586

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 51/108 (47%), Positives = 66/108 (61%), Gaps = 2/108 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F     +FM+QGGD T   G+GG+SI+G  F+DE N  L H+G GV+SMAN+G  TN
Sbjct: 383 GLIFHRSIKNFMIQGGDPTG-TGSGGESIWGKPFKDELNSKLIHSGRGVVSMANSGPHTN 441

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           GSQFFI       L+ +H VFG VV G+  +  +E +      RPL E
Sbjct: 442 GSQFFILYKSAPHLNFKHTVFGMVVGGLTTLSAMEKVPVDDDDRPLEE 489



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 26/57 (45%), Positives = 33/57 (57%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + +EL  D+TP+TCENF   C  E G+ Y G IFHR I  +   +G  PT T  G
Sbjct: 354 GDLNLELHCDITPRTCENFLTHC--ENGY-YNGLIFHRSIK-NFMIQGGDPTGTGSG 406


>09_06_0098 +
           20850535-20850612,20851258-20851333,20851474-20851521,
           20851758-20851781,20851875-20851994,20852235-20852310,
           20852385-20852547
          Length = 194

 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 1/116 (0%)
 Frame = +1

Query: 199 HWRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSM 378
           H  + L  +G  F    P FM+QGGD    +G G                      V++M
Sbjct: 82  HKGKSLHYKGSRFHRIIPGFMIQGGDIVRGDGKGS---------------------VIAM 120

Query: 379 ANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRE 543
           AN+G D+NGSQF+ITT+KTSWLDG HVVFG V++GM+ V  IE  A T  G+P ++
Sbjct: 121 ANSGPDSNGSQFYITTIKTSWLDGEHVVFGRVIQGMDYVYAIEGGAGTYNGKPRKK 176



 Score = 70.9 bits (166), Expect = 9e-13
 Identities = 38/71 (53%), Positives = 46/71 (64%), Gaps = 11/71 (15%)
 Frame = +2

Query: 74  GKMSLP----RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG------- 220
           G++ LP    RV+ DV +D   +G+IVI L  DV PKT  NFRALCTGE+G G       
Sbjct: 29  GEVRLPAVTNRVYLDVEIDGQHIGRIVIGLYGDVVPKTVANFRALCTGEEGIGHKGKSLH 88

Query: 221 YKGSIFHRVIP 253
           YKGS FHR+IP
Sbjct: 89  YKGSRFHRIIP 99


>01_05_0478 -
           22587881-22588021,22588126-22588266,22588436-22588643,
           22589199-22589238,22589425-22589647,22590826-22590970,
           22591053-22591156,22591298-22591396,22591506-22591684,
           22591948-22592167
          Length = 499

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGAD-TNGSQFFITTV 429
           F++QGGD T  +GTGG+SIYG  F DE  T L+    G+++ ANAG   +NGSQFFI+  
Sbjct: 61  FLVQGGDPTG-SGTGGESIYGAPFADEFHTRLRFNHRGLVACANAGTPHSNGSQFFISLD 119

Query: 430 KTSWLDGRHVVFGNV 474
           +  WLD ++ +FG V
Sbjct: 120 RCDWLDKKNTIFGKV 134



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 23/57 (40%), Positives = 30/57 (52%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + IEL     PK   NF  LC   +G+ Y G++FHRVI  S   +G  PT +  G
Sbjct: 22  GPLDIELWPKEAPKAVRNFVQLCL--EGY-YDGTLFHRVIK-SFLVQGGDPTGSGTG 74


>03_06_0417 -
           33782577-33782687,33782996-33783052,33783110-33783205,
           33783252-33783284,33783543-33783599,33783968-33784060,
           33784308-33784395,33784812-33784835,33784956-33785164
          Length = 255

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 30/55 (54%), Positives = 37/55 (67%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           +G  F      FM+QGGD+   +GTG  SIYG KF+DENF  KHTGPG+LSM  +
Sbjct: 87  KGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTKFDDENFIAKHTGPGLLSMVRS 141



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---KGF--GYKGSIFHRVI 250
           P VFFDVT+   P G+I +EL +D+ PKT ENFR  CTGE    G   GYKG  FHRVI
Sbjct: 37  PVVFFDVTIGSIPAGRIKMELFADIVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRVI 95



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +1

Query: 409 QFFITTVKTSWLDGRHVVFGNVV-EGMEVVKQIETLA 516
           QFFIT  K  WLD +HVVFG V+ +GM  V++IE +A
Sbjct: 200 QFFITCAKCEWLDNKHVVFGRVLGDGMLAVRKIENVA 236


>06_03_1076 +
           27409107-27409204,27409731-27409835,27409915-27410032,
           27410180-27410230,27410328-27410419,27410558-27410657,
           27411018-27411137,27411227-27411295,27411468-27411514,
           27411597-27411652,27412293-27412333,27412570-27412675,
           27413891-27414023,27414096-27414645
          Length = 561

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 48/134 (35%), Positives = 70/134 (52%), Gaps = 16/134 (11%)
 Frame = +1

Query: 190 CPVHWRERLRL------QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIY----GNK---FE 330
           CP+  +  L+L       G  F      F+ Q GD T   G GG S+Y    G++   F+
Sbjct: 21  CPLTTKNFLKLCKMKYYNGCLFHKVEKDFLAQTGDPTG-TGAGGDSVYKFLYGDQARFFD 79

Query: 331 DE-NFTLKHTGPGVLSMANAGADTNGSQFFIT-TVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           DE    L+H+  G ++MA+AG + N SQF+IT      +LD +H VFG V EG + + +I
Sbjct: 80  DEIRPDLRHSKKGTIAMASAGENCNASQFYITLRDDVDYLDDKHTVFGMVAEGFDTLTKI 139

Query: 505 -ETLAATLGRPLRE 543
            ET     GRP ++
Sbjct: 140 SETYVDDKGRPFKD 153



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           +G I ++L +D+ P T +NF  LC   K   Y G +FH+V      + G  PT T  G
Sbjct: 9   VGDIEVDLHTDMCPLTTKNFLKLC---KMKYYNGCLFHKVEKDFLAQTG-DPTGTGAG 62


>07_01_0566 +
           4207894-4207974,4208090-4208144,4208671-4208759,
           4209742-4209794,4209966-4210120,4210201-4210528,
           4210618-4210730,4211394-4211538,4211951-4212259,
           4212340-4212420,4212989-4213349
          Length = 589

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 8/62 (12%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           P VFFD+ +      +I  EL +DV PKT ENFRALCTGE+G G        +KG+  HR
Sbjct: 8   PHVFFDIAIGGRAAERITFELFADVVPKTTENFRALCTGERGLGVSTQKPLYFKGTNMHR 67

Query: 245 VI 250
           ++
Sbjct: 68  IL 69



 Score = 35.9 bits (79), Expect = 0.032
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +1

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
           V TS +  +HVVFG VV GM ++K++E + +  G+P  E
Sbjct: 87  VSTSCVS-KHVVFGKVVTGMPLLKKLEAVGSDTGKPTCE 124


>06_03_1075 +
           27399279-27399376,27399449-27399555,27400791-27400898,
           27401763-27401860,27401983-27402033,27402137-27402228,
           27402360-27402459,27402765-27402884,27402977-27403045,
           27403299-27403345,27403428-27403483,27404760-27404800,
           27405155-27405260,27406728-27406860,27406937-27407357
          Length = 548

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)
 Frame = +1

Query: 325 FEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK-TSWLDGRHVVFGNVVEGMEVVK 498
           F+DE +  L+H+  G ++MA+AG + N SQF+IT      +LD +H VFG V EG + + 
Sbjct: 108 FDDEIHPELRHSKMGTIAMASAGENCNASQFYITLRDGVDYLDDKHTVFGMVAEGFDTIT 167

Query: 499 QI-ETLAATLGRPLRE 543
           +I ET     GRP ++
Sbjct: 168 KINETYVDDKGRPFKD 183



 Score = 33.1 bits (72), Expect = 0.22
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHR 244
           +G I ++L +D+ P T +NF  LC G +G    G  F +
Sbjct: 9   VGDIEVDLHTDMCPLTTKNFLKLCKGNEGLVAGGLAFRK 47


>07_03_0359 -
           17201711-17201803,17202185-17202332,17202437-17202574,
           17204331-17204416,17205233-17205283,17205774-17205858,
           17205930-17206081
          Length = 250

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDEN-FTLKHTGPGVLSMANAGADT 399
           +G+ F     +F++QGGDF + NG   + I   K   EN  + KH    + +  N   + 
Sbjct: 131 KGMPFRHVIKNFVIQGGDF-DFNGAAQEWILKAKASGENALSPKHEAFMIGTTKNP--NN 187

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
            G   FITT     L+ + VVFG V+ G ++V++IE
Sbjct: 188 KGFDLFITTAPIPDLNDKLVVFGQVINGQDIVQEIE 223


>02_01_0086 + 613113-613532
          Length = 139

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 24/59 (40%), Positives = 32/59 (54%)
 Frame = +1

Query: 331 DENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           +ENF L H  P    + N  A+ N SQFF    +  W DG +VVFG ++ G   +K IE
Sbjct: 63  NENFLLPHDRPW---LPNGSAENNISQFF---TRVPWFDGNYVVFGCIISGFHNLKAIE 115



 Score = 31.5 bits (68), Expect = 0.68
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 143 IELRSDVTPKTCENFRALCTGEKGFGYKG 229
           +EL +D+ P T ENFRAL T +K   YKG
Sbjct: 1   MELYADLVPLTAENFRALYT-KKPLHYKG 28


>11_06_0322 +
           22358505-22358642,22358690-22358791,22359444-22359557,
           22359643-22359791,22360155-22360227,22360308-22360397,
           22360752-22360791,22361579-22361661,22362614-22362775
          Length = 316

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +1

Query: 343 TLKHTGPGVLSMA-NAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           T+KH   G+LSM  ++  ++ GS F I       LDG++ VFG + +G + ++++E L
Sbjct: 156 TVKHVR-GILSMGRHSDPNSGGSSFSILLGDAPHLDGQYAVFGRLTKGDDTLRKLEQL 212


>10_01_0310 + 3425099-3425218
          Length = 39

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTG 205
           G +VIE  +D  PKT ENFR +CTG
Sbjct: 8   GSVVIEQFADKVPKTTENFRPMCTG 32


>08_02_0053 + 11721658-11721689,11721960-11722710
          Length = 260

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +2

Query: 116 DDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           D  PLG+++  L   + P T  NF+A CT      Y+G++ H+++
Sbjct: 123 DSEPLGRVIFGLYGRLLPLTTANFKAACTSA---AYRGTLVHKLL 164



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 12/60 (20%)
 Frame = +1

Query: 340 FTLKHTGPGVLSMANAGADTNGS----------QFFITTVKTSW--LDGRHVVFGNVVEG 483
           F LKH  PG LS+     D +            +F +TT       LDG+++VFG V+EG
Sbjct: 201 FELKHARPGTLSLCLGQNDDDDDIKLNPNYHNVEFLVTTGPGPCPELDGQNIVFGTVLEG 260


>01_01_0077 - 585670-585787,585921-586687
          Length = 294

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           + F DV++   P G+I I L  D  P     F +L T   G GY+   F +++P
Sbjct: 76  KAFLDVSIGGEPAGRITIGLFGDAAPAGASRFLSLVT---GVGYRRKEFVKIVP 126



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           G   NG++F ITT     LD   +V G VV+GM+V+ +I
Sbjct: 202 GVVPNGTEFVITTGDAPELDASALVVGRVVDGMDVLGKI 240


>03_05_0695 - 26851370-26851495,26852949-26853398
          Length = 191

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +2

Query: 440 GWMADMLSLGMLLKAWKLSSRLRLWQPLWEDL 535
           G  A +LSL   +  W +++R+RLW+P+ E++
Sbjct: 139 GVQAKLLSLLSEISNWFINARVRLWKPMVEEM 170


>12_02_1032 +
           25542420-25542573,25543511-25543577,25543816-25543918,
           25544435-25544505,25544639-25544702,25545260-25545316,
           25545435-25545593,25545967-25546035,25546111-25546202,
           25546579-25546657,25546923-25547088,25547480-25547604,
           25547737-25548078,25548271-25548432,25548520-25548624,
           25548766-25548860,25548948-25549044,25549848-25550165,
           25550228-25550296
          Length = 797

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/52 (34%), Positives = 27/52 (51%)
 Frame = -3

Query: 228 PL*PKPFSPVHRARKFSHVLGVTSLLSSITIFPSGASSTVTSKNTRGRDILP 73
           PL   P SP+   R+  H +  + +  +++  PS +SSTVTS    G D  P
Sbjct: 722 PLLLSPRSPMSELRRPLH-MPFSPVRKAVSPSPSSSSSTVTSPRNAGEDQKP 772


>11_01_0361 +
           2772193-2772334,2773457-2773587,2773872-2773985,
           2774303-2774459,2774577-2775000,2775238-2776030,
           2776182-2776241,2776952-2777593
          Length = 820

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 190 CPVHWRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNK 324
           CP H+ E + L+  H  + + +  L   D  NH+ +   S YGNK
Sbjct: 284 CPSHFVE-INLEKQHHLNGYTNHKLNEKDIFNHSNSSAFSRYGNK 327


>07_03_1767 +
           29338867-29338912,29339261-29339325,29339571-29339642,
           29339913-29339956,29340047-29340158,29340879-29340950,
           29341449-29341511,29341957-29342034,29342110-29342202,
           29342294-29342413,29342762-29342845,29343094-29343309,
           29343401-29343448,29343761-29343871,29344170-29344267,
           29345004-29345248,29345764-29345832,29345919-29345983,
           29346168-29346337,29346434-29346512,29346614-29346869,
           29347416-29347461,29347602-29347710,29347820-29347882,
           29350075-29350107,29350924-29351442
          Length = 991

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = -3

Query: 369 DARSSVLKGEILVFKLIAVDGLSPSAVMVGEV 274
           DA  +V  GEIL+ ++  V G++PS V++ ++
Sbjct: 778 DAFVNVQNGEILLIEVNTVPGMTPSTVLIHQI 809


>05_02_0115 -
           6758540-6758771,6759417-6759524,6759670-6759840,
           6759967-6760077,6760562-6760663,6761139-6761366,
           6761568-6761696,6761753-6761869,6761955-6762301,
           6762377-6762931,6763104-6763182,6763429-6763595,
           6763857-6764075,6764956-6765139,6765175-6765371,
           6765717-6766035,6766379-6766538,6767642-6767794,
           6767911-6768013
          Length = 1226

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 22/80 (27%), Positives = 33/80 (41%)
 Frame = -3

Query: 528 SQSGCQSLNLLDNFHAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARSSVL 349
           ++S  +SL  L N  +    P      +   G+D+ DE  GT       SH E   S   
Sbjct: 566 TKSALESLPDLKNVDSVAEPPLTEQEKVVSNGMDAPDELAGTSVNLDSTSHCEGEPSRAD 625

Query: 348 KGEILVFKLIAVDGLSPSAV 289
            GE+    +   DG S S++
Sbjct: 626 NGELKGNLIDEEDGTSDSSL 645


>02_03_0180 - 16031366-16031445,16031950-16032022,16032148-16032186,
            16032434-16032715,16032790-16032948,16033034-16033390,
            16033482-16033622,16033919-16034045,16034121-16034263,
            16034740-16034917,16035019-16035552,16035628-16035812,
            16036551-16036637,16036710-16036850,16036896-16037175,
            16037944-16038020,16038326-16039138,16039292-16039801,
            16039926-16040056,16040192-16040246,16040364-16040564,
            16040640-16040909,16041103-16041184,16041271-16041434,
            16041532-16041690,16041762-16042083,16042158-16042544,
            16042811-16042999,16043233-16043317,16043458-16043753,
            16043862-16043965,16044484-16044513,16044602-16044817,
            16044923-16045540,16045718-16045993,16046619-16046762,
            16046854-16046962,16047291-16047475,16047557-16047670,
            16048348-16048479,16048929-16049249,16049424-16049891,
            16054482-16054547,16054691-16054828,16054917-16055015,
            16057098-16057194,16057661-16057761,16057858-16058085,
            16059175-16059381,16059451-16059571,16059921-16059988,
            16060148-16060213,16060396-16060509,16060949-16061300,
            16063571-16063663,16063764-16063922,16064224-16064287,
            16064385-16064577,16064673-16064710,16065510-16065645,
            16065726-16065914,16065994-16066095,16067660-16067777,
            16067861-16067964,16070338-16070346,16071428-16071475,
            16071581-16071676,16072430-16072533,16073964-16074045,
            16076573-16076601,16076708-16076963
          Length = 4246

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = -1

Query: 500  CLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAM 375
            C T ++P +T PK+  L +S   L V M+N +   S  ALA+
Sbjct: 2901 CFTAALPLSTIPKS--LNNSHFALEVTMRNGKKHASLRALAI 2940


>06_01_0719 +
           5239238-5239635,5239735-5239945,5240379-5240454,
           5240573-5240675,5241089-5241157,5241318-5241354,
           5241445-5241519,5241598-5241649,5241752-5241796,
           5241994-5242080,5242348-5242445
          Length = 416

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 8/18 (44%), Positives = 15/18 (83%)
 Frame = +3

Query: 78  KCLYHEYSSTSLLTMPHW 131
           +CL+HEY+++S + +P W
Sbjct: 396 RCLFHEYNTSSQIFLPIW 413


>03_01_0014 +
           113638-113754,113836-113950,114570-114835,115365-115575,
           115915-115979,118723-118930,119457-119566,119663-119913,
           120250-120356,120442-120509,120624-120701,121070-121198,
           121341-121481,122297-122344,122648-122743,124071-124183,
           124441-124591,124745-124818,124913-125072,125356-125454,
           125532-125618,125761-125907
          Length = 946

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 14/25 (56%), Positives = 17/25 (68%)
 Frame = -3

Query: 402 ISISTGISHGEDARSSVLKGEILVF 328
           ++I T I HG D R+S L GE LVF
Sbjct: 119 LAILTAIFHGVDPRTSFLIGEGLVF 143


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,305,076
Number of Sequences: 37544
Number of extensions: 502685
Number of successful extensions: 1452
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1354
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1433
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1839213168
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -