SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0677 - 19388888-19389019,19389124-19389216,19389317-193894...    81   8e-16
01_07_0018 - 40488702-40488833,40488928-40489020,40489125-404892...    81   1e-15
08_02_0211 - 14333553-14333684,14333795-14333887,14334019-143341...    75   4e-14
06_01_1127 + 9294079-9294193,9294300-9294369,9294611-9294716,929...    31   0.67 
06_03_0392 + 20318728-20319309,20319596-20319725,20319844-203198...    31   0.89 
02_05_0610 - 30342105-30342266,30343024-30343129,30343788-303438...    30   1.6  
09_04_0719 + 19716536-19716857,19716949-19717101,19717493-197177...    29   4.8  
01_01_1106 + 8750597-8754031                                           29   4.8  
04_04_0188 - 23433753-23436572                                         28   6.3  
02_04_0587 + 24110333-24110584,24111193-24111261,24112347-241128...    28   6.3  

>09_04_0677 -
           19388888-19389019,19389124-19389216,19389317-19389445,
           19389559-19389728,19390280-19390481,19390576-19390623,
           19390797-19390799
          Length = 258

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/66 (57%), Positives = 49/66 (74%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           HVT L+E+ KAQL      + P+   ++LPALCRKM VPYCIVKGK+RLG++VH+KT + 
Sbjct: 134 HVTYLIEQSKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKARLGSIVHKKTASV 193

Query: 686 LALTNV 703
           L LT V
Sbjct: 194 LCLTTV 199



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 34/55 (61%), Positives = 43/55 (78%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 398
           L +  K PK +RIQRQ+ +L++RLKVPP +NQFT+TLDK  A  LFK+L KYRPE
Sbjct: 44  LHRFVKWPKVVRIQRQRRILKQRLKVPPALNQFTRTLDKNLATNLFKMLLKYRPE 98



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSI 264
           NPLFEKRPK F IG  + P +DL RFV+ P +
Sbjct: 22  NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKV 53


>01_07_0018 -
           40488702-40488833,40488928-40489020,40489125-40489253,
           40489379-40489500,40490292-40490544,40490636-40490638
          Length = 243

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 37/66 (56%), Positives = 49/66 (74%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           HVT L+E+ KAQL      + P+   ++LPALCRKM +PYCIVKGK+RLG++VH+KT + 
Sbjct: 119 HVTYLIEQSKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVHKKTASV 178

Query: 686 LALTNV 703
           L LT V
Sbjct: 179 LCLTTV 184



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 26/55 (47%), Positives = 39/55 (70%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 398
           L +  + PK +RIQRQ+ VL++RLKVPP +NQFT+TLDK       ++L++ + E
Sbjct: 45  LHRFVRWPKAVRIQRQRRVLKQRLKVPPALNQFTRTLDKNLGCQKERLLKRAQAE 99



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKRPK F IG  + P +DL RFVR P
Sbjct: 23  NPLFEKRPKQFGIGGALPPRKDLHRFVRWP 52


>08_02_0211 -
           14333553-14333684,14333795-14333887,14334019-14334105,
           14334220-14334389,14334985-14335186,14335604-14335606
          Length = 228

 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 34/55 (61%), Positives = 43/55 (78%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 398
           L +  K PK +RIQRQ+ +L++RLKVPP +NQFT+TLDK  A  LFK+L KYRPE
Sbjct: 28  LHRFVKWPKVVRIQRQRRILKQRLKVPPALNQFTRTLDKNLATNLFKMLLKYRPE 82



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSI 264
           NPLFEKRPK F IG  + P +DL RFV+ P +
Sbjct: 6   NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKV 37



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 26/66 (39%), Positives = 35/66 (53%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           HVT L+E+ KAQL      + P+   ++LPALCRKM               +VH+KT + 
Sbjct: 118 HVTYLIEQSKAQLVVIAHDVDPIELVVWLPALCRKM--------------EIVHKKTASV 163

Query: 686 LALTNV 703
           L LT V
Sbjct: 164 LCLTTV 169


>06_01_1127 +
           9294079-9294193,9294300-9294369,9294611-9294716,
           9295665-9295805,9296377-9296475
          Length = 176

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 2/67 (2%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRL--GALVHRKT 676
           K V K + + +  L      + P+     +P LC +  +PY  V  K  L       R T
Sbjct: 50  KEVVKSIRRGQKGLCIIAGNISPIDVITHVPILCEEANIPYVYVPSKEDLATAGTTKRPT 109

Query: 677 CTCLALT 697
           C  L LT
Sbjct: 110 CCVLVLT 116


>06_03_0392 +
           20318728-20319309,20319596-20319725,20319844-20319895,
           20319995-20320061,20320547-20320633,20322526-20322567,
           20322635-20322740,20323155-20323219,20323299-20323343,
           20323442-20323549,20323636-20323723,20324147-20324193,
           20324355-20324363
          Length = 475

 Score = 31.1 bits (67), Expect = 0.89
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 266 PHPAPEGCTSASSESAPSDQP 328
           P PAPE   +A+ E+APSD P
Sbjct: 53  PQPAPEEAPAAAEEAAPSDDP 73


>02_05_0610 -
           30342105-30342266,30343024-30343129,30343788-30343857,
           30343978-30344092
          Length = 150

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 18/67 (26%), Positives = 26/67 (38%), Gaps = 2/67 (2%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRL--GALVHRKT 676
           K V K + +    L      + P+     +P LC +  +PY  V  K  L       R T
Sbjct: 50  KEVVKSIRRGNKGLCVIAGNISPIDVITHVPILCEEANIPYIYVPSKEDLATAGTTKRPT 109

Query: 677 CTCLALT 697
           C  L +T
Sbjct: 110 CCVLVMT 116


>09_04_0719 +
           19716536-19716857,19716949-19717101,19717493-19717707,
           19717785-19717855,19717998-19718157,19718598-19718790,
           19718936-19719091,19719229-19719317,19719602-19719695,
           19719870-19720039
          Length = 540

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = -1

Query: 282 SGAGCGYTWASYKSGQVPSWLNALTNGKVLWPLLEERIHDLLG 154
           +GAG GY W S+++    +W  A+   K LW  L   +  L G
Sbjct: 105 TGAGQGYLWMSHRTPGSDTWELAV-RSKQLWEELAAEVDGLGG 146


>01_01_1106 + 8750597-8754031
          Length = 1144

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
 Frame = +1

Query: 577 LVSLPASVMP*NGRTILHCQG----QVPPRCTCTPQDMHMLSSNKCG 705
           LV+LP+S+       +L+ +G    ++ P   C+ Q++H L+ ++CG
Sbjct: 530 LVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCG 576


>04_04_0188 - 23433753-23436572
          Length = 939

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = +3

Query: 219 SANSGLVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 347
           SA + L Q+CK        RQ A    R + PPP + +   LD
Sbjct: 21  SAGASLRQLCKDGDLREALRQLAARSARGRAPPPTDHYGWVLD 63


>02_04_0587 +
           24110333-24110584,24111193-24111261,24112347-24112850,
           24113094-24113336
          Length = 355

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 15/31 (48%), Positives = 17/31 (54%)
 Frame = -3

Query: 214 PDQWQSSLASSRREDSRSSWAQPF*PPMGRR 122
           P    SSLA +RR  +R   AQP  PP  RR
Sbjct: 24  PSSAASSLAFARRAAARPLRAQPLLPPAARR 54


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,984,210
Number of Sequences: 37544
Number of extensions: 394406
Number of successful extensions: 1483
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1409
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1479
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1815633512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -