SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0538 + 29841801-29842280,29842559-29842930,29843013-29843309     91   6e-19
05_03_0396 - 13477465-13477761,13477970-13478341,13478414-13478887     87   1e-17
11_06_0633 + 25681756-25682061,25682961-25683329,25683419-25683733     77   1e-14
05_06_0233 + 26599068-26599466,26601214-26601829,26601871-266019...    72   5e-13
03_01_0644 - 4719954-4720022,4720445-4720912,4721009-4721312,472...    50   2e-06
01_06_0447 + 29452194-29452361,29453232-29453317,29453403-294536...    48   1e-05
07_03_0117 + 13589997-13590998                                         47   1e-05
05_07_0283 - 28937027-28937110,28937211-28937549,28937641-289377...    46   2e-05
01_05_0410 + 21914995-21915168,21915268-21915353,21915446-219156...    45   5e-05
03_02_0489 + 8836306-8836500,8836906-8837082,8837175-8837321,883...    44   9e-05
02_02_0134 + 7082462-7082627,7084199-7084325,7084404-7084611,708...    42   7e-04
02_01_0763 - 5665010-5665202,5665285-5665375,5665460-5666245,566...    41   9e-04
06_03_0691 + 23552437-23552914,23555168-23555953,23556045-235561...    41   0.001
01_01_0282 - 2349336-2349583,2349719-2349786,2349880-2349950,235...    41   0.001
04_04_0048 + 22351788-22352177,22353175-22353711                       40   0.002
01_01_1139 - 9024609-9024708,9024832-9024910,9025083-9025252,902...    38   0.006
10_07_0101 - 12872296-12873288                                         36   0.024
01_07_0083 + 40970890-40971015,40971886-40971994,40972679-409727...    36   0.043
03_01_0534 + 3996479-3997458,3997938-3998265                           35   0.057
05_01_0505 + 4207841-4208455,4209982-4210143,4210247-4210717           35   0.075
06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627     34   0.099
10_08_1015 - 22255135-22255693,22256437-22256836,22257938-222583...    34   0.13 
11_08_0097 + 28330565-28330645,28330768-28330986,28331066-283311...    33   0.23 
01_01_0877 - 6878905-6879600,6880696-6880968                           33   0.30 
03_02_0469 + 8720119-8720199,8720295-8720372,8720496-8720570,872...    32   0.40 
09_04_0303 - 16505782-16506902,16507232-16507292                       32   0.53 
01_03_0118 - 12688137-12688162,12688236-12688395,12689442-126895...    32   0.53 
07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759,420...    31   1.2  
05_04_0010 - 17132810-17132935,17133017-17133169,17133202-171332...    31   1.2  
01_05_0099 - 18098169-18098390,18098878-18098972,18099063-180991...    31   1.2  
09_04_0683 - 19431034-19431495,19431632-19431997,19432055-194323...    30   1.6  
02_02_0123 + 7015905-7015928,7015975-7016105,7017675-7017940,701...    30   1.6  
07_03_1727 + 29068348-29068571,29069473-29069514,29069593-290698...    30   2.1  
07_01_0586 - 4354613-4354996,4355537-4355662,4355752-4355827,435...    30   2.1  
05_01_0092 - 609537-609941,610067-610328,610624-610731,611083-61...    30   2.1  
08_01_0151 + 1186678-1187042,1187926-1188043                           29   2.8  
06_01_0755 + 5648872-5649471,5650092-5650453,5650576-5650619,565...    29   2.8  
04_01_0497 - 6522998-6523669,6523684-6523716                           29   2.8  
08_01_0148 + 1172975-1173340                                           29   3.7  
03_06_0002 + 30917082-30917146,30917594-30917975,30918083-309182...    29   3.7  
10_06_0119 - 10956190-10956754,10956984-10957139,10958402-10958622     29   4.9  
06_03_1455 + 30264023-30264174,30265930-30266070,30266328-302664...    29   4.9  
03_05_0967 + 29265465-29266214,29267718-29267944,29268428-292685...    29   4.9  
02_04_0226 + 21073967-21074179,21074711-21074832,21074926-210753...    29   4.9  
12_01_0019 - 135627-135983,136564-136797,137118-137196,137268-13...    28   6.5  
11_01_0021 - 143576-143932,144434-144667,144988-145066,145138-14...    28   6.5  
09_04_0437 - 17587944-17588909                                         28   6.5  
07_01_1210 - 11538233-11538349,11538532-11538612,11538697-115387...    28   6.5  
03_03_0192 - 15308602-15308869,15309457-15309528,15310271-153103...    28   6.5  
02_01_0768 + 5736778-5737341,5737451-5737612,5738678-5738707           28   6.5  
09_04_0608 + 18924648-18924899,18926341-18926435,18926903-189272...    28   8.6  
08_02_1016 - 23606089-23607072                                         28   8.6  
07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145...    28   8.6  
03_05_1041 - 29884975-29885107,29885485-29885552,29885652-298858...    28   8.6  
03_02_0148 - 5928703-5928931,5929099-5929171,5929288-5929408,592...    28   8.6  

>02_05_0538 + 29841801-29842280,29842559-29842930,29843013-29843309
          Length = 382

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 48/89 (53%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN ANVIRYFPTQALNFAFKD +K++F    D K  +W++F            
Sbjct: 141 GFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD-KDGYWKWFGGNLASGGAAGA 199

Query: 428 TSLCFVYPLDFARTRLAAD--VGKGDGQR 508
           +SL FVY LD+ARTRLA D    KG G+R
Sbjct: 200 SSLFFVYSLDYARTRLANDAKAAKGGGER 228



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 1/60 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL GG+SAAVSKTA APIERVKLL+Q Q  + K     + YKGI D F R  K++G
Sbjct: 82  FMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 141



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +   K  KSDG+ GLYRGF
Sbjct: 230 FNGLVDVYRKTLKSDGIAGLYRGF 253


>05_03_0396 - 13477465-13477761,13477970-13478341,13478414-13478887
          Length = 380

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G ++ WRGN ANVIRYFPTQALNFAFKD +K++F    D K  +W++F            
Sbjct: 139 GVIALWRGNTANVIRYFPTQALNFAFKDHFKRMFNFKKD-KDGYWKWFAGNLASGGAAGA 197

Query: 428 TSLCFVYPLDFARTRLAAD---VGKGDGQR 508
            SL FVY LD+ARTRLA D     KG G++
Sbjct: 198 CSLFFVYSLDYARTRLANDAKAAKKGGGRQ 227



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DF+ GG+SAAVSKTA APIER+KLL+Q Q  + K       YKGI D F R  K++G
Sbjct: 80  FMIDFMMGGVSAAVSKTAAAPIERIKLLIQNQDEMIKSGRLSHPYKGIADCFGRTIKDEG 139

Query: 252 L 254
           +
Sbjct: 140 V 140



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +   K   SDG+ GLYRGF
Sbjct: 228 FNGLVDVYRKTLASDGIAGLYRGF 251


>11_06_0633 + 25681756-25682061,25682961-25683329,25683419-25683733
          Length = 329

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 40/88 (45%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK-KTQFWRYFXXXXXXXXXXX 424
           G  + WRGN ANVIRYFPTQA NFAFK  +K +F  G DK K   W++            
Sbjct: 83  GVAALWRGNQANVIRYFPTQAFNFAFKGYFKSIF--GYDKEKDGKWKWLAGNVASGSAAG 140

Query: 425 XTSLCFVYPLDFARTRLAADVGKGDGQR 508
            T+   +Y LD+ARTRLA D  +  G +
Sbjct: 141 ATTSSLLYHLDYARTRLATDAIESQGSK 168



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (1%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQ 248
           A A DF  GG +A V+KT  AP+ERVKLLLQ Q  + ++ +  + Y+GI DAF R+ +E+
Sbjct: 23  AAAADFAMGGAAAVVAKTGAAPVERVKLLLQNQAEMLRRGSLTRPYRGIADAFGRVLREE 82

Query: 249 GL 254
           G+
Sbjct: 83  GV 84



 Score = 32.3 bits (70), Expect = 0.40
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           FSGL +   K  K+DG+ GLYRGF
Sbjct: 171 FSGLLDVYKKTLKTDGIRGLYRGF 194


>05_06_0233 +
           26599068-26599466,26601214-26601829,26601871-26601917,
           26602101-26602268
          Length = 409

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL-GGVDKKTQFWRYFXXXXXXXXXXX 424
           G LS WRGN   VIRY+P+ ALNF+ KD Y+ +    G     +F               
Sbjct: 107 GVLSLWRGNGTAVIRYYPSVALNFSLKDLYRSILKDAGTSADNKFSSIALTNFIAGAAAG 166

Query: 425 XTSLCFVYPLDFARTRLAADVGKGD 499
            T+L  +YPLD A TRLAAD+G+ D
Sbjct: 167 CTTLVLIYPLDIAHTRLAADIGRTD 191



 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQ-IAADQRYKGIVDAFVRIPKEQG 251
           F +D +AG        T VAPIER KLLLQ Q  +   +   +R++G  D   R  +++G
Sbjct: 48  FERDLVAGAAMGGAVHTVVAPIERAKLLLQTQDGNAALLGRARRFRGFADCVARTVRDEG 107

Query: 252 L 254
           +
Sbjct: 108 V 108


>03_01_0644 -
           4719954-4720022,4720445-4720912,4721009-4721312,
           4722321-4722745
          Length = 421

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL--GGVDKKTQFWRYFXXXXXXXXXX 421
           G   FW+GNF N++R  P +A+NF   D Y++  L   G D+ T F R+           
Sbjct: 176 GLKGFWKGNFVNILRTAPFKAVNFYAYDTYRKQLLKWSGNDETTNFERFI---AGAAAGV 232

Query: 422 XXTSLCFVYPLDFARTRLAADVGKGDG 502
             T LC   P+D  RTR+ A  G+  G
Sbjct: 233 TATILCI--PMDTIRTRMVAPGGEALG 257



 Score = 31.9 bits (69), Expect = 0.53
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKL 155
           A  +   K   +G ++A VS+T VAP+ER+KL
Sbjct: 122 AGAMNMTKHLWSGAVAAMVSRTVVAPLERLKL 153


>01_06_0447 +
           29452194-29452361,29453232-29453317,29453403-29453610,
           29454252-29454381,29454561-29454745,29454858-29454989,
           29455747-29455851
          Length = 337

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 19/32 (59%), Positives = 28/32 (87%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           FAK+ +AGG++ A SKTA+AP+ER+K+LLQ +
Sbjct: 27  FAKEMIAGGVAGAFSKTAIAPLERLKILLQTR 58



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 28/97 (28%), Positives = 42/97 (43%)
 Frame = +2

Query: 209 GYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 388
           G  + L+   Q  G L F++GN A+V+R  P  AL++   ++Y+   L            
Sbjct: 66  GVLKSLKKLKQHDGILGFYKGNGASVLRIVPYAALHYMAYERYRCWILNNCPS---LGTG 122

Query: 389 FXXXXXXXXXXXXTSLCFVYPLDFARTRLAADVGKGD 499
                        T++   YPLD ART+LA  V   D
Sbjct: 123 PLVDLLAGSASGGTAVLCTYPLDLARTKLAFQVNSSD 159


>07_03_0117 + 13589997-13590998
          Length = 333

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 32/94 (34%), Positives = 43/94 (45%)
 Frame = +2

Query: 197 PALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQ 376
           P   G  + LR   +G G    +RGN AN +R F T+AL+F   ++YK+  LG       
Sbjct: 75  PRGAGAVQMLREIGRGEGVAGLFRGNGANALRVFHTKALHFMAYERYKRFLLGAA---PS 131

Query: 377 FWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLA 478
                            T++   YPLD ARTRLA
Sbjct: 132 LGDGPVVDLLAGSAAGGTAVLATYPLDLARTRLA 165



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/48 (45%), Positives = 32/48 (66%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           AFA++ +AGG++  V+KTAVAP+ERV L+ QV    +   A Q  + I
Sbjct: 40  AFAREMVAGGVAGVVAKTAVAPLERVNLMRQVGAAPRGAGAVQMLREI 87


>05_07_0283 -
           28937027-28937110,28937211-28937549,28937641-28937754,
           28937843-28937955,28939050-28939087,28939315-28939478,
           28939746-28939794,28940986-28941152
          Length = 355

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/62 (38%), Positives = 37/62 (59%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++  K   AGG++  VS+TAVAP+ER+K+LLQVQ+         +Y G +     I + +
Sbjct: 41  LSICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN-----PHSIKYNGTIQGLKYIWRTE 95

Query: 249 GL 254
           GL
Sbjct: 96  GL 97


>01_05_0410 +
           21914995-21915168,21915268-21915353,21915446-21915656,
           21915869-21915998,21916740-21916924,21917014-21917145,
           21917329-21917433
          Length = 340

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/32 (59%), Positives = 27/32 (84%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +AK+ +AGG + A +KTAVAP+ERVK+LLQ +
Sbjct: 29  YAKELIAGGAAGAFAKTAVAPLERVKILLQTR 60


>03_02_0489 +
           8836306-8836500,8836906-8837082,8837175-8837321,
           8837636-8837737,8837824-8837894,8837992-8838059,
           8838595-8838836
          Length = 333

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 2/80 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQV--FLGGVDKKTQFWRYFXXXXXXXXXX 421
           G  +FW+GN   +    P  +++F   ++YK +   + G+D+   F              
Sbjct: 93  GFRAFWKGNLVTIAHRLPYSSISFYTYERYKNLLQMIPGLDRNGGFGADVGVRLIGGGLS 152

Query: 422 XXTSLCFVYPLDFARTRLAA 481
             T+    YPLD  RTRLAA
Sbjct: 153 GITAASMTYPLDLVRTRLAA 172



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAGG++ AVSKT  AP+ R+ +L QVQ +   +A   R   I     RI  E+G
Sbjct: 41  LAGGVAGAVSKTCTAPLARLTILFQVQGMHSDVAT-MRKTSIWREASRIVYEEG 93


>02_02_0134 +
           7082462-7082627,7084199-7084325,7084404-7084611,
           7084864-7084990,7085071-7085255,7085332-7085454,
           7085777-7085836,7085980-7086117
          Length = 377

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/35 (51%), Positives = 28/35 (80%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           P+A  ++ +AGG++  V+KTAVAP+ERVK+L Q +
Sbjct: 23  PLA-VRELVAGGVAGGVAKTAVAPLERVKILFQAR 56



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 25/80 (31%), Positives = 37/80 (46%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L F+RGN A+V R  P  AL++   ++Y++  + G     Q                 
Sbjct: 92  GLLGFYRGNGASVARIVPYAALHYMAYEEYRRWIILGFPNVEQGP---ILDLVAGSIAGG 148

Query: 428 TSLCFVYPLDFARTRLAADV 487
           T++   YPLD  RT+LA  V
Sbjct: 149 TAVICTYPLDLVRTKLAYQV 168



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+ +C+  I++ +GL GLYRG
Sbjct: 186 YKGILDCVKTIYRQNGLRGLYRG 208


>02_01_0763 -
           5665010-5665202,5665285-5665375,5665460-5666245,
           5667745-5668225
          Length = 516

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 16/31 (51%), Positives = 26/31 (83%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +K  +AGG+S A S+TA AP++R+K+++QVQ
Sbjct: 234 SKYLIAGGVSGATSRTATAPLDRLKVIMQVQ 264



 Score = 31.5 bits (68), Expect = 0.70
 Identities = 16/41 (39%), Positives = 27/41 (65%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQ 164
           +K  N +D +  +   +AGG++ AV++TA+ PI+ VK  LQ
Sbjct: 318 SKGENKSD-IGTSGRLMAGGLAGAVAQTAIYPIDLVKTRLQ 357


>06_03_0691 +
           23552437-23552914,23555168-23555953,23556045-23556135,
           23556214-23556406
          Length = 515

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/38 (44%), Positives = 29/38 (76%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           ++  V  +K  +AGGI+ A S+TA AP++R+K+++QVQ
Sbjct: 226 ISKSVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQ 263



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 12/25 (48%), Positives = 20/25 (80%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQ 164
           +AGG++ AV++TA+ P++ VK  LQ
Sbjct: 332 VAGGLAGAVAQTAIYPVDLVKTRLQ 356



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 1/77 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV-DKKTQFWRYFXXXXXXXXXXX 424
           G L+F+RGN  NV++  P  A+ F   +  K+  +    + K++                
Sbjct: 281 GMLAFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGP--SERLVAGGLAG 338

Query: 425 XTSLCFVYPLDFARTRL 475
             +   +YP+D  +TRL
Sbjct: 339 AVAQTAIYPVDLVKTRL 355


>01_01_0282 -
           2349336-2349583,2349719-2349786,2349880-2349950,
           2350022-2350123,2350309-2350449,2350540-2350716,
           2352228-2352338
          Length = 305

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/53 (41%), Positives = 32/53 (60%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           AGG + AVSKT  AP+ R+ +L QV  +   +AA ++Y  I     RI +E+G
Sbjct: 14  AGGFAGAVSKTCTAPLARLTILFQVAGMHSDVAALKKY-SIWHEASRIVREEG 65



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
 Frame = +2

Query: 257 SFWRGNFANVIRYFPTQALNFAFKDKYKQVF--LGGVDKKTQFWRYFXXXXXXXXXXXXT 430
           +FW+GN   ++   P  A++F   ++YK+    + G+D+ + +                T
Sbjct: 68  AFWKGNLVTIVHRLPYSAISFYSYERYKKFLQRVPGLDEDSNY--VGVARLLSGGLAGIT 125

Query: 431 SLCFVYPLDFARTRLA 478
           +    YPLD  RTRLA
Sbjct: 126 AASVTYPLDVVRTRLA 141


>04_04_0048 + 22351788-22352177,22353175-22353711
          Length = 308

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAGG+S  V++   +P + +K+ +Q            RY GI DAF +I + +G
Sbjct: 120 LAGGVSGVVAQVVASPADLIKVRMQADSRLLSQGIQPRYTGIFDAFTKIVRAEG 173


>01_01_1139 -
           9024609-9024708,9024832-9024910,9025083-9025252,
           9025339-9025451,9025518-9025586,9025867-9025944,
           9026022-9026084,9026590-9026670,9027166-9027222,
           9027352-9027705
          Length = 387

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           F AG  + AV+KT  AP++RVKLL+Q   V  ++  +   KGI
Sbjct: 93  FAAGAAAGAVAKTITAPLDRVKLLMQTHSV--RVVGESTKKGI 133



 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRGF 582
           + I  I + DGLIGLYRGF
Sbjct: 325 DAIPGIVERDGLIGLYRGF 343


>10_07_0101 - 12872296-12873288
          Length = 330

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           +A+P A A    AGG+SAAV+   V  P++ V   L VQ      AA   Y+G  DA  R
Sbjct: 131 VAEPAASAAASAAGGVSAAVAAQVVWTPVDVVSQRLMVQ----TAAAGPPYRGGADALRR 186

Query: 234 IPKEQGL 254
           I +  G+
Sbjct: 187 ILRADGV 193



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G  + + +I ++DG+ GLYRGFG
Sbjct: 177 YRGGADALRRILRADGVRGLYRGFG 201


>01_07_0083 +
           40970890-40971015,40971886-40971994,40972679-40972790,
           40972944-40973100,40973609-40973761,40974143-40974292,
           40974803-40974999,40975446-40975473
          Length = 343

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 8/65 (12%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ--------HVSKQIAADQRYKGIVDAFVRIP 239
           D LAG IS  +S+T  +P++ +K+  QVQ         + + +    +Y G++ A   I 
Sbjct: 16  DALAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGVLRRDVYGPSKYTGLLQASKDIL 75

Query: 240 KEQGL 254
           +E+G+
Sbjct: 76  REEGI 80


>03_01_0534 + 3996479-3997458,3997938-3998265
          Length = 435

 Score = 35.1 bits (77), Expect = 0.057
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           +++P A A    AGG+SAA++   V  P++ +   L VQ      ++  RY+G VDAF +
Sbjct: 126 VSEPAATAAASAAGGVSAAIAAQVVWTPVDVISQRLMVQ-----TSSTCRYRGGVDAFKK 180

Query: 234 IPKEQGL 254
           I    G+
Sbjct: 181 ILLADGV 187



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G  +   KI  +DG+ GLYRGFG
Sbjct: 171 YRGGVDAFKKILLADGVRGLYRGFG 195


>05_01_0505 + 4207841-4208455,4209982-4210143,4210247-4210717
          Length = 415

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           K  ++GGI+ AVS+TAVAP+E ++  L V
Sbjct: 136 KRLISGGIAGAVSRTAVAPLETIRTHLMV 164



 Score = 31.9 bits (69), Expect = 0.53
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 1/85 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALN-FAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXX 424
           G    +RGNF NVIR  P++A+  FAF    K  FL     + +                
Sbjct: 183 GWTGLFRGNFVNVIRVAPSKAIELFAFDTANK--FLTPKSGEQKKVPLPPSLVAGAFAGV 240

Query: 425 XTSLCFVYPLDFARTRLAADVGKGD 499
            ++LC  YPL+  +TRL    G  D
Sbjct: 241 SSTLC-TYPLELIKTRLTIQRGVYD 264


>06_03_0677 - 23440273-23440749,23440824-23440985,23442007-23442627
          Length = 419

 Score = 34.3 bits (75), Expect = 0.099
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALN-FAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXX 424
           G    +RGNF NVIR  P++A+  FAF D  K+      D+  +    F           
Sbjct: 185 GWTGLFRGNFVNVIRVAPSKAIELFAF-DTAKKFLTPKADESPK--TPFPPSLIAGALAG 241

Query: 425 XTSLCFVYPLDFARTRLAAD 484
            +S    YPL+  +TRL  +
Sbjct: 242 VSSTLCTYPLELIKTRLTIE 261



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV 167
           ++G ++ AVS+T VAP+E ++  L V
Sbjct: 141 VSGAVAGAVSRTCVAPLETIRTHLMV 166


>10_08_1015 -
           22255135-22255693,22256437-22256836,22257938-22258371,
           22259586-22259977
          Length = 594

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           L+GG++ AV   +V P + VK ++QV    K      RY G VDAF +I    G+
Sbjct: 214 LSGGLAGAVFWLSVYPTDVVKSVIQVDDYKKP-----RYSGSVDAFKKILAADGV 263



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           +SG  +   KI  +DG+ GLY+GFG
Sbjct: 247 YSGSVDAFKKILAADGVKGLYKGFG 271



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           +SG  +   KI  +DG+ GLY+GFG
Sbjct: 545 YSGSMDAFRKILAADGVKGLYKGFG 569


>11_08_0097 +
           28330565-28330645,28330768-28330986,28331066-28331144,
           28331222-28331355,28331447-28331545,28331638-28331742,
           28332377-28332451,28333671-28333757,28333854-28333889
          Length = 304

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V   K   AG  + A++ +   P + VK+ LQ +       A +RY G +DA+ +I +++
Sbjct: 114 VPLTKKIAAGFTTGAIAISIANPTDLVKVRLQAEGKLAP-GAPRRYAGAMDAYAKIVRQE 172

Query: 249 G 251
           G
Sbjct: 173 G 173


>01_01_0877 - 6878905-6879600,6880696-6880968
          Length = 322

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + A   ++GG++   S     P++ VK  LQ Q          RY+GI D F R  +E+G
Sbjct: 222 SLATMLVSGGLAGVASWVCCYPLDVVKSRLQAQ------GYPPRYRGIADCFRRSVREEG 275

Query: 252 L 254
           L
Sbjct: 276 L 276



 Score = 31.9 bits (69), Expect = 0.53
 Identities = 17/68 (25%), Positives = 38/68 (55%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           S++++P ++    LAG  + A+    ++P+E VK+ LQ++   ++      + G VD   
Sbjct: 110 SSMSEPPSYTSVALAGVGTGALQTLILSPVELVKIRLQLEAAGQKHRRPGDHHGPVDMAR 169

Query: 231 RIPKEQGL 254
            I +++G+
Sbjct: 170 DILRKEGV 177


>03_02_0469 +
           8720119-8720199,8720295-8720372,8720496-8720570,
           8720666-8720796,8720948-8721002,8721107-8721217,
           8721538-8721606,8721687-8721794,8722106-8722174,
           8722266-8722320,8722499-8722701
          Length = 344

 Score = 32.3 bits (70), Expect = 0.40
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 2/80 (2%)
 Frame = +3

Query: 21  LVKIT*SNKMSNL--ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           L+K     + SNL  AD +   + FL G ++   +     P+  VK  LQV+ +      
Sbjct: 214 LLKKLKKRRASNLKGADGLTALEIFLLGAVAKLGATVVTYPLLVVKARLQVKQIIDDDKR 273

Query: 195 DQRYKGIVDAFVRIPKEQGL 254
             RYKG  DA  ++ + +GL
Sbjct: 274 -HRYKGTFDAITKMIRYEGL 292


>09_04_0303 - 16505782-16506902,16507232-16507292
          Length = 393

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           +PVA A    A G++AAV+   V  P++ +   L VQ          RY+G +DAF +I 
Sbjct: 170 EPVASAAAGAAAGLAAAVAAQVVWTPVDVISQRLMVQG---NPCPASRYRGGLDAFRKIV 226

Query: 240 KEQGL 254
              GL
Sbjct: 227 AADGL 231



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 12/16 (75%), Positives = 13/16 (81%)
 Frame = +1

Query: 538 KIFKSDGLIGLYRGFG 585
           KI  +DGL GLYRGFG
Sbjct: 224 KIVAADGLRGLYRGFG 239


>01_03_0118 -
           12688137-12688162,12688236-12688395,12689442-12689583,
           12689680-12689876,12690374-12690755,12692317-12692399
          Length = 329

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G  + ISK+ +++GL GLYRGFG
Sbjct: 171 YRGPFDVISKVVRTEGLRGLYRGFG 195


>07_01_0566 +
           4207894-4207974,4208090-4208144,4208671-4208759,
           4209742-4209794,4209966-4210120,4210201-4210528,
           4210618-4210730,4211394-4211538,4211951-4212259,
           4212340-4212420,4212989-4213349
          Length = 589

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = -1

Query: 494 PYRHRRRDGYVRSRGGTRSTERWLRRH-HRRPDYQRSNARTASSCQRR 354
           P R+ RRD   RSR  +RS  R+  R  +RRP  + S +R+ +  QRR
Sbjct: 468 PSRYPRRD---RSRSRSRSPLRYRERGGYRRPSPRHSRSRSPAEHQRR 512


>05_04_0010 -
           17132810-17132935,17133017-17133169,17133202-17133263,
           17133384-17133435,17133794-17133883,17134075-17134170,
           17134258-17134311,17134575-17134665,17134996-17135072,
           17135770-17135852,17136057-17136111
          Length = 312

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           +AGG +  V +TA+ PI+ +K  LQ      QI     Y G+
Sbjct: 22  IAGGTAGVVVETALYPIDTIKTRLQAARGGSQIQWKGLYSGL 63


>01_05_0099 -
           18098169-18098390,18098878-18098972,18099063-18099131,
           18099277-18099352,18101412-18101524,18104137-18104185,
           18104540-18104572,18105446-18105552,18106892-18106990,
           18107122-18107203
          Length = 314

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAAD-QRYKGIVDAFVRIPKEQGL 254
           +AGG +  +S T + P++ +K  LQV  +   +++     + I+  F  I K +GL
Sbjct: 22  IAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGL 77



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 8/23 (34%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G+ +CI ++++ +G+ G YRG
Sbjct: 260 YTGVIDCIKQVYQKEGIPGFYRG 282


>09_04_0683 -
           19431034-19431495,19431632-19431997,19432055-19432326,
           19433621-19433686,19433924-19433978,19434509-19434577,
           19435200-19435307,19435394-19435462,19435883-19436038,
           19436089-19436229,19436514-19436568,19437103-19437233,
           19437382-19437486
          Length = 684

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQV-QHVSKQIAADQRYKGIVDAFVRIPKEQGL--F 257
           FL G I+   +     P+  VK  LQ  Q + + + +  RY G +DA +++ + +GL  F
Sbjct: 257 FLLGAIAKLGATVVTYPLLVVKSRLQAKQEIGRNVMS--RYTGTIDAIIKMIRYEGLHGF 314

Query: 258 HSGV 269
           + G+
Sbjct: 315 YKGM 318


>02_02_0123 +
           7015905-7015928,7015975-7016105,7017675-7017940,
           7018239-7018327,7018716-7018811,7018874-7018969,
           7019121-7019251,7020123-7020177,7020645-7020800,
           7021238-7021306,7021392-7021499,7022128-7022196,
           7022743-7022797,7023031-7023227
          Length = 513

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQV-QHVSKQIAADQRYKGIVDAFVRIPKEQGL--F 257
           FL G I+   +     P+  VK  LQ  Q + + + +  RY G +DA +++ + +GL  F
Sbjct: 409 FLLGAIAKLGATVVTYPLLVVKSRLQAKQEIGRNVMS--RYTGTIDAIIKMIRYEGLHGF 466

Query: 258 HSGV 269
           + G+
Sbjct: 467 YKGM 470


>07_03_1727 +
           29068348-29068571,29069473-29069514,29069593-29069839,
           29069936-29070013,29070551-29070736,29070829-29071126,
           29071775-29072244
          Length = 514

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 152 AAAPSTARQQADRRRPALQGYRRRLRPHPQG 244
           AAA ++    + R RP L  +R  L+PHPQG
Sbjct: 4   AAAAASYSSTSWRVRPGLTPFRSPLQPHPQG 34


>07_01_0586 -
           4354613-4354996,4355537-4355662,4355752-4355827,
           4356444-4356651,4356813-4356906,4357430-4357504,
           4358200-4358622
          Length = 461

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = -3

Query: 537 ADAVSETGELRWPSPLPTSAARRVRAKSRGY 445
           A A S  G   +PSP+P +AA      SRGY
Sbjct: 62  APAASPDGAAIYPSPMPAAAAEAAARWSRGY 92


>05_01_0092 -
           609537-609941,610067-610328,610624-610731,611083-611204,
           611295-611366,611531-611590,611692-611874
          Length = 403

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 13/49 (26%), Positives = 27/49 (55%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVIS 689
           L++ ++D ++  F  V A   ++ A+Y+G  D  + +L   + TP+  S
Sbjct: 97  LKLLQADANILMFDSVHARTCLHHAAYYGHVDCLQAILAAAQTTPVADS 145


>08_01_0151 + 1186678-1187042,1187926-1188043
          Length = 160

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           +R G     RW RRH    D ++  AR+A+   RRR
Sbjct: 87  ARAGVMEEIRWRRRHEDARDKRKRKARSAARRFRRR 122


>06_01_0755 +
           5648872-5649471,5650092-5650453,5650576-5650619,
           5651324-5651538,5651643-5651767,5651862-5651931
          Length = 471

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +1

Query: 517 GLGNCISKIFKSDGLIGLYRG 579
           GLG+ + K  KS+G +GLY+G
Sbjct: 305 GLGDGLPKFIKSEGALGLYKG 325



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +3

Query: 72  AFAKDFLAGGI-SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           AF     AGGI S  ++  AV P++ VK  +Q+           +YK I   F  + KEQ
Sbjct: 169 AFYAACTAGGIASCGLTHMAVTPLDLVKCNMQIDPA--------KYKSITSGFGILAKEQ 220

Query: 249 GL 254
           G+
Sbjct: 221 GV 222


>04_01_0497 - 6522998-6523669,6523684-6523716
          Length = 234

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 182 ADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQA 310
           A +RR  +  +RRR    P  AGSL+  +G  A++++ +  +A
Sbjct: 2   AMKRRTTMVAWRRRRPSDPVAAGSLTSVKGRAASILKPYSRRA 44


>08_01_0148 + 1172975-1173340
          Length = 121

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           +R G     RW RRH    D ++  AR+A    RRR
Sbjct: 86  ARAGVMEEIRWRRRHEDARDKRKRKARSAGRRFRRR 121


>03_06_0002 +
           30917082-30917146,30917594-30917975,30918083-30918279,
           30918372-30918513,30919287-30919415,30919460-30919471
          Length = 308

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 538 KIFKSDGLIGLYRGFG 585
           +I K+DG+ GLYRGFG
Sbjct: 174 QIIKADGIRGLYRGFG 189


>10_06_0119 - 10956190-10956754,10956984-10957139,10958402-10958622
          Length = 313

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = -1

Query: 503 GHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASS 366
           G   Y H R DG+ R   G      WL RHH     + S A+  ++
Sbjct: 164 GDRDYGHWRHDGFGRLAEGVADGYFWLVRHHLDEGLETSLAQRGAA 209


>06_03_1455 +
           30264023-30264174,30265930-30266070,30266328-30266430,
           30266510-30266659,30267184-30267229,30267383-30267738
          Length = 315

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRR 405
           P P +Y GH  Y  R   G  RSRGG    + +    +RR
Sbjct: 191 PTPGSYLGH-RYDRREPRGRYRSRGGGYGRDEYYGNSYRR 229


>03_05_0967 +
           29265465-29266214,29267718-29267944,29268428-29268557,
           29268651-29268719,29268803-29268946,29269775-29270011,
           29270897-29270998,29271131-29271396,29271766-29273410,
           29274449-29275018
          Length = 1379

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 4/59 (6%)
 Frame = -1

Query: 569 RPIRPSDLKILLMQFPRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRR----HHRR 405
           R I+P   +  L    R + Y  H PY +R RD   RS    R TE W RR    H+RR
Sbjct: 831 RDIKPDVERSHLASRSRDDTY--H-PYANRDRDMRGRSYDRVRDTEIWQRREESVHNRR 886


>02_04_0226 +
           21073967-21074179,21074711-21074832,21074926-21075370,
           21075453-21075559,21075656-21076463,21076691-21077128,
           21077349-21077537,21077616-21077843,21077943-21078140,
           21078304-21078379,21078452-21078593,21078749-21079238
          Length = 1151

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 22/66 (33%), Positives = 29/66 (43%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGT 345
           P P   A  +P R RRR   +R RGG  +T   +    R  D +R     A SC+ R   
Sbjct: 28  PSPPVVA-RVPPRIRRRL-LLRHRGGAPATAEEIEAKLRDADLRRQQFHEALSCKARCTV 85

Query: 344 PACTCP 327
              +CP
Sbjct: 86  RYPSCP 91


>12_01_0019 -
           135627-135983,136564-136797,137118-137196,137268-137383,
           137847-137991,138177-138594,138644-138649,139315-139945
          Length = 661

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 179
           K  LAGG+++A+S + + PI+ +K  +Q   +S
Sbjct: 377 KSALAGGLASALSTSVMHPIDSMKTRVQASSLS 409


>11_01_0021 -
           143576-143932,144434-144667,144988-145066,145138-145253,
           145717-145861,146048-146465,147206-147869
          Length = 670

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 179
           K  LAGG+++A+S + + PI+ +K  +Q   +S
Sbjct: 386 KSALAGGLASALSTSVMHPIDSMKTRVQASSLS 418


>09_04_0437 - 17587944-17588909
          Length = 321

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           +SG  +C+ K  +S+G + LY+GF
Sbjct: 268 YSGALDCLIKTVRSEGAMALYKGF 291


>07_01_1210 -
           11538233-11538349,11538532-11538612,11538697-11538758,
           11539108-11539159,11539779-11539868,11539957-11540052,
           11540127-11540180,11540314-11540404,11540731-11540807,
           11541089-11541171,11541441-11541492
          Length = 284

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           +AGG +  V +TA+ PI+ +K  LQ      +I     Y G+
Sbjct: 21  IAGGAAGVVVETALYPIDTIKTRLQAAKGGSKIQWKGLYAGL 62


>03_03_0192 -
           15308602-15308869,15309457-15309528,15310271-15310337,
           15310449-15310528,15310636-15310714,15310815-15310890
          Length = 213

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 22/84 (26%), Positives = 31/84 (36%)
 Frame = -1

Query: 581 KPLYRPIRPSDLKILLMQFPRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRP 402
           KP  R   PS  +     + R   Y      RH R D   R    +RS ER+ R  ++  
Sbjct: 112 KPRGRSRSPSPKRRYRADY-RDRGYRDDYRDRHYRDDYQDREYRRSRSIERYERERYQEK 170

Query: 401 DYQRSNARTASSCQRRRGTPACTC 330
            Y+R +   +    RR       C
Sbjct: 171 GYRRRSRSISPDYDRRHRKNGYAC 194


>02_01_0768 + 5736778-5737341,5737451-5737612,5738678-5738707
          Length = 251

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV 167
           ++G I+ AVS+T VAP+E ++  L V
Sbjct: 132 VSGAIAGAVSRTFVAPLETIRTHLMV 157


>09_04_0608 +
           18924648-18924899,18926341-18926435,18926903-18927236,
           18927345-18927582,18927813-18928069
          Length = 391

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 367
           G    W GN  N+IR  PTQA+     +  K+      +K
Sbjct: 140 GWQGLWAGNTINMIRIIPTQAIELGTFECVKRTMAEAQEK 179


>08_02_1016 - 23606089-23607072
          Length = 327

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           +SG  +C  K  +S+G++ LY+GF
Sbjct: 274 YSGAIDCALKTVRSEGVMALYKGF 297


>07_01_1143 -
           10711023-10711884,10713603-10713826,10714253-10714522,
           10715071-10715175
          Length = 486

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 19/65 (29%), Positives = 25/65 (38%)
 Frame = -1

Query: 515 ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
           E +A     R R    Y  S G  R+ +  L+     P Y+R+ A   S   R   T   
Sbjct: 116 EYFAEEHDRRARAGIDYDSSNGKARANDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGA 175

Query: 335 TCP*R 321
            CP R
Sbjct: 176 ECPYR 180


>03_05_1041 -
           29884975-29885107,29885485-29885552,29885652-29885816,
           29886262-29886372,29886999-29887072,29887387-29887480,
           29887750-29887849,29888075-29888151,29888856-29888935,
           29889025-29889157
          Length = 344

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           +SG  + +  I K +G + LYRG G
Sbjct: 157 YSGFSDALRTILKEEGWLALYRGIG 181


>03_02_0148 -
           5928703-5928931,5929099-5929171,5929288-5929408,
           5929907-5929952,5930361-5930571,5930837-5930986,
           5931122-5931179,5931285-5931400,5931986-5932091
          Length = 369

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 3/63 (4%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK---EQGLF 257
           F+AGGI   +      P E +K  +QVQ   K  A     KG +      P      G+F
Sbjct: 138 FIAGGIGDTLGSFIYVPCEVMKQRMQVQGTKKSWALTAT-KGNISQTPGAPMYNYYNGMF 196

Query: 258 HSG 266
           H+G
Sbjct: 197 HAG 199


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,130,185
Number of Sequences: 37544
Number of extensions: 367060
Number of successful extensions: 1642
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 1474
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1631
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -