SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0926 - 7775536-7775616,7775695-7775787,7775903-7775965,777...   122   4e-28
03_06_0475 + 34193951-34194023,34195414-34195486,34195572-341956...   121   5e-28
01_05_0340 - 21139885-21139978,21140169-21140272,21140379-211405...   120   1e-27
01_01_0565 - 4159946-4160042,4160140-4160243,4160378-4160533,416...   120   1e-27
02_05_0161 + 26384079-26384086,26386173-26386226,26386376-263864...   118   5e-27
05_05_0118 - 22504483-22504566,22504650-22504742,22504852-225049...   104   9e-23
06_03_0414 - 20548577-20549006,20553521-20553744                      100   1e-21
05_06_0082 - 25425050-25425479,25426551-25426783                      100   1e-21
01_06_1343 - 36461476-36461961,36463355-36463519                      100   1e-21
01_06_0712 + 31397167-31397402,31399823-31400252                      100   3e-21
01_06_0186 + 27294973-27295211,27295610-27296045                       99   4e-21
06_03_1387 - 29820358-29821035                                         98   6e-21
05_07_0127 - 27872803-27873238,27873842-27874059                       98   6e-21
05_01_0036 + 253734-253904,255216-255707                               98   6e-21
09_02_0464 - 9591139-9591571,9592601-9592818                           98   8e-21
05_03_0286 - 11623575-11624063,11625098-11625262                       97   2e-20
03_01_0326 + 2535800-2535938,2536891-2536959,2537310-2537375,253...    95   4e-20
08_02_1318 - 26111031-26111276,26112139-26112427,26112936-261130...    95   7e-20
09_02_0222 + 5968232-5968467,5970811-5971187,5972216-5972256,597...    94   1e-19
09_06_0029 + 20336634-20336881,20337737-20338208                       93   2e-19
07_03_1397 + 26269186-26269525,26269727-26269932,26270225-262703...    92   5e-19
10_08_0250 - 16179646-16179759,16180197-16180325,16180519-161806...    91   9e-19
02_04_0402 + 22618998-22619043,22619206-22619345,22620067-226201...    90   2e-18
05_01_0037 - 256891-256998,257347-257502,257753-257824,258737-25...    89   3e-18
03_06_0501 - 34380155-34380637,34380961-34381029,34382206-343822...    88   8e-18
03_06_0637 - 35219212-35219754,35220405-35220587                       85   8e-17
04_04_0191 + 23468410-23468455,23468560-23468699,23469119-234692...    84   1e-16
07_03_0473 - 18525712-18525858,18526049-18526162,18526442-185265...    83   2e-16
07_01_0685 - 5177340-5177363,5177770-5177865,5177991-5178053,517...    81   7e-16
10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731,729...    80   2e-15
10_06_0181 - 11532765-11533203,11536867-11537036                       78   9e-15
01_01_0893 + 7043130-7043182,7043309-7043335,7043461-7043560,704...    76   4e-14
03_01_0365 - 2839190-2839251,2839637-2839694,2839946-2840032,284...    71   1e-12
12_02_1213 + 27058329-27058370,27058634-27058711,27058807-270589...    65   5e-11
03_05_0601 + 26039326-26039367,26039958-26040035,26040136-260403...    64   2e-10
05_03_0590 - 15884485-15884489,15884702-15884790,15885086-158852...    63   3e-10
03_01_0647 + 4745788-4745907,4746510-4746591,4746847-4746958,474...    62   5e-10
10_08_0165 + 15356748-15356811,15357113-15357186,15357311-153573...    60   2e-09
06_03_1187 + 28267535-28267568,28267620-28267645,28267808-282679...    59   4e-09
05_06_0080 + 25420371-25420423,25420681-25420780,25421742-254218...    58   6e-09
06_03_0668 + 23301578-23301791,23302102-23302199,23302233-233023...    55   5e-08
05_07_0205 - 28402436-28402505,28402604-28402681,28402789-284029...    54   2e-07
01_05_0673 + 24183512-24183514,24183625-24183694,24184203-241842...    53   3e-07
06_01_0907 + 7001946-7002050,7002389-7002476,7002606-7002679,700...    52   4e-07
05_06_0217 + 26457847-26457902,26458336-26458435,26458551-264586...    52   5e-07
02_05_1357 + 35899480-35899578,35900247-35900334,35900438-359005...    52   5e-07
02_02_0624 - 12323702-12323777,12324219-12324304,12324360-123244...    52   5e-07
02_01_0155 - 1080923-1081024,1081111-1081176,1081306-1081370,108...    52   5e-07
02_05_0708 - 31103246-31103359,31104146-31104178,31104297-311043...    50   2e-06
05_06_0061 + 25274693-25274794,25274982-25275069,25275186-252752...    50   2e-06
07_03_0638 + 20196216-20196650,20196810-20196930,20197072-201971...    44   2e-04
07_01_0842 + 6840943-6841288,6841800-6841970,6842762-6842832,684...    41   0.001
05_05_0295 - 23912502-23912507,23912631-23912712,23913020-239131...    41   0.001
03_06_0420 + 33794045-33794192,33794831-33794901,33795093-337952...    41   0.001
01_06_1108 + 34574299-34574446,34575000-34575070,34575246-345753...    41   0.001
01_01_1138 - 9019049-9019159,9019525-9019606,9020059-9020177,902...    41   0.001
06_01_0098 + 818374-818427,818537-818627,818753-818868,818962-81...    40   0.002
03_02_0046 - 5255513-5255630,5255715-5255876,5256579-5256733,525...    40   0.002
02_01_0226 + 1476529-1476585,1477207-1477297,1478247-1478362,147...    38   0.012
02_02_0711 - 13180406-13180423,13180483-13180563,13181026-131811...    37   0.015
01_01_0909 - 7163886-7163931,7164148-7164254,7164370-7164435,716...    33   0.026
02_05_0413 + 28773869-28773925,28774045-28774135,28774515-287746...    36   0.027
10_08_1062 + 22626262-22626318,22626404-22626494,22626601-226267...    36   0.035
02_05_0639 - 30552148-30552265,30552362-30552523,30553177-305532...    34   0.14 
08_01_0921 + 9075409-9075511,9075606-9075689,9075744-9075806,907...    31   0.76 
07_03_1468 - 26739872-26740912                                         29   3.1  
11_03_0182 + 11307275-11307368,11307485-11307594,11307654-113078...    29   5.3  
12_01_0957 + 9531045-9531069,9531904-9531971,9532659-9532882,953...    28   7.1  
11_01_0773 + 6461854-6461961,6462225-6462483,6462727-6462958,646...    28   9.3  
07_03_1298 - 25592788-25592890,25593126-25593229,25593747-255938...    28   9.3  
01_01_0018 + 139150-140415                                             28   9.3  

>07_01_0926 -
           7775536-7775616,7775695-7775787,7775903-7775965,
           7776326-7776423,7776661-7776761,7776865-7776937,
           7778575-7778647
          Length = 193

 Score =  122 bits (293), Expect = 4e-28
 Identities = 56/71 (78%), Positives = 64/71 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD L KLLLIGDSGVGK+ +L RFS+ +F  SFI+TIGIDFKIRTI+LDGK++KLQIWDT
Sbjct: 12  YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDT 71

Query: 215 AGQERFRTITT 247
           AGQERFRTITT
Sbjct: 72  AGQERFRTITT 82



 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query: 280 VYDVTNEKSFE----NIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGEQLAI 444
           ++D   ++ F     +I+NWIRNIE++AS +V K+++GNK D+D S+R V   +G+ LA 
Sbjct: 68  IWDTAGQERFRTITTDIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALAD 127

Query: 445 EYQIKFVETSAKDSLNVEYAF 507
           EY IKF ETSAK +LNVE  F
Sbjct: 128 EYGIKFFETSAKTNLNVEQVF 148


>03_06_0475 +
           34193951-34194023,34195414-34195486,34195572-34195672,
           34195912-34196009,34196326-34196388,34196534-34196626,
           34196697-34196774
          Length = 192

 Score =  121 bits (292), Expect = 5e-28
 Identities = 55/71 (77%), Positives = 64/71 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD L KLLLIGDSGVGK+ +L RFS+ +F  SFI+TIGIDFKIRT++LDGK++KLQIWDT
Sbjct: 12  YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTVELDGKRIKLQIWDT 71

Query: 215 AGQERFRTITT 247
           AGQERFRTITT
Sbjct: 72  AGQERFRTITT 82



 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query: 280 VYDVTNEKSFE----NIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGEQLAI 444
           ++D   ++ F     +I+NWIRNIE++AS +V K+++GNK D+D S+R V   +G+ LA 
Sbjct: 68  IWDTAGQERFRTITTDIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALAD 127

Query: 445 EYQIKFVETSAKDSLNVEYAF 507
           EY IKF ETSAK +LNVE  F
Sbjct: 128 EYGIKFFETSAKTNLNVEQVF 148


>01_05_0340 -
           21139885-21139978,21140169-21140272,21140379-21140534,
           21140622-21140693,21140782-21140829,21140923-21140970,
           21141807-21141879,21142333-21142346
          Length = 202

 Score =  120 bits (289), Expect = 1e-27
 Identities = 54/77 (70%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D++  S+ISTIG+DFKIRT++ DGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score =  100 bits (240), Expect = 1e-21
 Identities = 47/88 (53%), Positives = 64/88 (72%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W+  I+  AS +V K+++GNKCDL   R VS E
Sbjct: 75  SSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRVVSYE 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G+ LA E  I F+ETSAKD+ NVE AF
Sbjct: 135 AGKALADEIGIPFLETSAKDATNVEKAF 162


>01_01_0565 -
           4159946-4160042,4160140-4160243,4160378-4160533,
           4160629-4160700,4161796-4161843,4161923-4161970,
           4162295-4162367,4163188-4163201
          Length = 203

 Score =  120 bits (289), Expect = 1e-27
 Identities = 54/77 (70%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D++  S+ISTIG+DFKIRT++ DGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score = 91.5 bits (217), Expect = 7e-19
 Identities = 42/88 (47%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W+  I+  AS +V K+++GNK DL + + VS E
Sbjct: 75  SSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTANKVVSSE 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             +  A E  I F+ETSAK++ NVE AF
Sbjct: 135 TAKAFADEMGIPFMETSAKNATNVEQAF 162


>02_05_0161 +
           26384079-26384086,26386173-26386226,26386376-26386448,
           26386775-26386822,26386906-26386953,26387990-26388061,
           26388156-26388311,26388428-26388531,26388628-26388724
          Length = 219

 Score =  118 bits (284), Expect = 5e-27
 Identities = 52/73 (71%), Positives = 66/73 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFKLLLIGDSGVGK+ +L RF++D++  S+ISTIG+DFKIRT++ DGK +KLQIWDT
Sbjct: 21  FDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDT 80

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT++Y
Sbjct: 81  AGQERFRTITSSY 93



 Score = 91.5 bits (217), Expect = 7e-19
 Identities = 42/88 (47%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W+  I+  AS +V K+++GNK DL + + VS E
Sbjct: 91  SSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTANKVVSSE 150

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             +  A E  I F+ETSAK++ NVE AF
Sbjct: 151 TAKAFADEMGIPFMETSAKNATNVEQAF 178


>05_05_0118 -
           22504483-22504566,22504650-22504742,22504852-22504914,
           22505048-22505145,22505378-22505478,22505581-22505653,
           22505872-22505910,22506946-22507018
          Length = 207

 Score =  104 bits (249), Expect = 9e-23
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 13/84 (15%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSG-------------VGKTSILFRFSEDAFNISFISTIGIDFKIRTID 175
           YD L KLLLIGDS              VGK+ +L RFS+ +F  SFI+TIGIDFKIRTI+
Sbjct: 12  YDYLIKLLLIGDSVFYKLFLVLSSIQCVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIE 71

Query: 176 LDGKKVKLQIWDTAGQERFRTITT 247
           LDGK++KLQIWDTAGQERFRTITT
Sbjct: 72  LDGKRIKLQIWDTAGQERFRTITT 95



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = +1

Query: 280 VYDVTNEKSFE----NIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGEQLAI 444
           ++D   ++ F     +I+NWIRNIE++AS +V K+++GNK D+D S+R V   +G+ LA 
Sbjct: 81  IWDTAGQERFRTITTDIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTAKGQALAD 140

Query: 445 EYQIKFVETSAKDSLNVEYAF 507
           EY IKF ETSAK +LNVE  F
Sbjct: 141 EYGIKFFETSAKTNLNVEQVF 161


>06_03_0414 - 20548577-20549006,20553521-20553744
          Length = 217

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/73 (60%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + F++   STIG++F  R++ +DGK VK QIWDT
Sbjct: 11  YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDT 70

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 71  AGQERYRAITSAY 83



 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 33/85 (38%), Positives = 54/85 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYDVT   +FEN++ W++ + ++   ++  M++GNK DL     V  + G+ 
Sbjct: 85  RGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLRHLVAVQTDEGKA 144

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F+ETSA +S NVE AF+
Sbjct: 145 FAERESLYFMETSALESTNVENAFA 169


>05_06_0082 - 25425050-25425479,25426551-25426783
          Length = 220

 Score =  100 bits (240), Expect = 1e-21
 Identities = 43/73 (58%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+++ F++   STIG++F  R++ +DGK +K QIWDT
Sbjct: 14  YDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLQVDGKVIKAQIWDT 73

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 74  AGQERYRAITSAY 86



 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYDVT   +F+N+  W+R + ++    +  M++GNK DL     VS E G++
Sbjct: 88  RGAVGALLVYDVTRRATFDNVGRWLRELRDHTDPSIVCMLIGNKSDLRHLVAVSTEDGKE 147

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F+ETSA D+ NV+ AF+
Sbjct: 148 FAEAESMYFMETSALDATNVDNAFA 172


>01_06_1343 - 36461476-36461961,36463355-36463519
          Length = 216

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/73 (60%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK++IL RF+ + F +   STIG++F  RT+ ++GK +K QIWDT
Sbjct: 9   YDYLFKIVLIGDSGVGKSNILSRFTRNEFFLESKSTIGVEFATRTLQIEGKTIKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 69  AGQERYRAITSAY 81



 Score = 81.4 bits (192), Expect = 7e-16
 Identities = 33/84 (39%), Positives = 60/84 (71%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  ++F+N++ W+R + ++A A++  M++GNK DL+  R V +E G  
Sbjct: 83  RGAVGALLVFDITKRQTFDNVQRWLRELRDHADANIVVMMVGNKSDLNHLRSVPEEDGHA 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            + +  + F+ETSA +++NVE AF
Sbjct: 143 FSEKEGLSFLETSALEAINVEKAF 166


>01_06_0712 + 31397167-31397402,31399823-31400252
          Length = 221

 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 45/73 (61%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK +LIGDSGVGK+++L RF+++ F +   STIG++F  R+I +DGK VK QIWDT
Sbjct: 15  YDYLFKTVLIGDSGVGKSNLLSRFTKNEFCLESKSTIGVEFATRSIQVDGKVVKAQIWDT 74

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 75  AGQERYRAITSAY 87



 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYDVT   +F+N+  W++ + ++    +  M++GNK DL     VS E G++
Sbjct: 89  RGAVGALLVYDVTRRATFDNVARWLKELRDHTDPSIVVMLVGNKSDLRHLVAVSTEDGKE 148

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F+ETSA D+ NVE AF+
Sbjct: 149 YAEAESLYFMETSALDATNVENAFA 173


>01_06_0186 + 27294973-27295211,27295610-27296045
          Length = 224

 Score = 98.7 bits (235), Expect = 4e-21
 Identities = 43/73 (58%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ D F++   STIG++F  +T+ +D + VK QIWDT
Sbjct: 16  YDYLFKVVLIGDSGVGKSNLLSRFARDEFSLETRSTIGVEFATKTVRVDDRLVKAQIWDT 75

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 76  AGQERYRAITSAY 88



 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 32/85 (37%), Positives = 52/85 (61%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G ++VYDVT   +FEN + W++ + ++  A++  M++GNK DL   R V  E    
Sbjct: 90  RGAVGALVVYDVTRRITFENAERWLKELRDHTDANIVVMLVGNKADLRHLRAVPAEDARA 149

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A  +    +ETSA ++ NVE AF+
Sbjct: 150 FAEAHGTFSMETSALEATNVEGAFT 174


>06_03_1387 - 29820358-29821035
          Length = 225

 Score = 98.3 bits (234), Expect = 6e-21
 Identities = 43/72 (59%), Positives = 59/72 (81%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D +FK+++IGDS VGKT +L RF++D F I   STIGI+F+ RT+++ GK+VK QIWDTA
Sbjct: 5   DYVFKVVVIGDSAVGKTQLLGRFTKDEFFIDSKSTIGIEFQTRTVEIGGKRVKAQIWDTA 64

Query: 218 GQERFRTITTAY 253
           GQER+R +T+AY
Sbjct: 65  GQERYRAVTSAY 76



 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 32/84 (38%), Positives = 48/84 (57%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G MLVYDVT+ +SF +   W+ ++  +A   +  M++GNK DL   R V+ +    
Sbjct: 78  RGALGAMLVYDVTSRRSFHHAARWLHDLRAHADNSIVVMLIGNKADLSHARAVAADEAAA 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F E SA    NVE AF
Sbjct: 138 FAEDQGLFFSEASALSGDNVEEAF 161


>05_07_0127 - 27872803-27873238,27873842-27874059
          Length = 217

 Score = 98.3 bits (234), Expect = 6e-21
 Identities = 44/73 (60%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + F++   STIG++F  R+I +D K VK QIWDT
Sbjct: 9   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 69  AGQERYRAITSAY 81



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 36/85 (42%), Positives = 58/85 (68%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G ++VYDVT   +FEN++ W+R ++++  A++  M++GNK DL   R VS E  + 
Sbjct: 83  RGAVGALVVYDVTRHVTFENVERWMRELKDHTDANIVIMLVGNKADLRHLRAVSTEDAKA 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +    F+ETSA +S+NVE AF+
Sbjct: 143 FAEKENTFFMETSALESMNVENAFT 167


>05_01_0036 + 253734-253904,255216-255707
          Length = 220

 Score = 98.3 bits (234), Expect = 6e-21
 Identities = 46/84 (54%), Positives = 64/84 (76%)
 Frame = +2

Query: 2   GTRIVVKMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLD 181
           GTR   +  + YD LFK++LIGDSGVGK+++L RF+ + F +   STIG++F  RT+ ++
Sbjct: 3   GTR---RAEEEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLHVE 59

Query: 182 GKKVKLQIWDTAGQERFRTITTAY 253
           GK +K QIWDTAGQER+R IT+AY
Sbjct: 60  GKIIKAQIWDTAGQERYRAITSAY 83



 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 33/86 (38%), Positives = 56/86 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYDV+   +F+NI  W++ + ++A A++  M++GNK DL   R V+ +   +
Sbjct: 85  RGALGAVLVYDVSKPTTFDNISRWLKELRDHADANIRIMLVGNKTDLKHLRAVATDDAHK 144

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFSL 513
            A    + ++ETSA ++ NVE AF L
Sbjct: 145 FAEAEGLSYIETSALEATNVEEAFQL 170


>09_02_0464 - 9591139-9591571,9592601-9592818
          Length = 216

 Score = 97.9 bits (233), Expect = 8e-21
 Identities = 44/73 (60%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + F++   STIG++F  R+I +D K VK QIWDT
Sbjct: 9   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 69  AGQERYRAITSAY 81



 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/85 (41%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G ++VYDVT   +FEN++ W++ + ++  A++  M++GNK DL   R VS E  + 
Sbjct: 83  RGAVGALVVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLRHLRAVSVEDAKG 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A      F+ETSA +S+NVE AF+
Sbjct: 143 FAERESTFFMETSALESMNVESAFT 167


>05_03_0286 - 11623575-11624063,11625098-11625262
          Length = 217

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 41/73 (56%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++LIGDSGVGK++IL RF+ + F++   STIG++F  +++ ++GK +K QIWDT
Sbjct: 9   YSYLFKMVLIGDSGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKTIKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 69  AGQERYRAITSAY 81



 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 36/84 (42%), Positives = 60/84 (71%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+T  +SF+N+  W+R + ++A + +  M++GNK DL   R VS++ G+ 
Sbjct: 83  RGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVIMMVGNKSDLIHLRAVSEDEGKA 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  + F+ETSA +++NVE AF
Sbjct: 143 LAEKEGLFFLETSAMEAVNVEEAF 166


>03_01_0326 +
           2535800-2535938,2536891-2536959,2537310-2537375,
           2537979-2538100,2538501-2538629,2540462-2540569
          Length = 210

 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +2

Query: 26  AKTYDCLFKLLLIGDSGVGKTSILFRF-SEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           A +YDC FK+LLIGDS VGK+S+L  F S    +     TIG+DFKI+ + ++GKK+KL 
Sbjct: 6   ASSYDCSFKILLIGDSAVGKSSLLVSFVSASHIDDEIAPTIGVDFKIKFLTVNGKKLKLT 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR IT++Y
Sbjct: 66  IWDTAGQERFRGITSSY 82



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKN-WIRNIE-ENASADVEKMILGNKCDLDSQRQVS 417
           +S  RG+ GI+LVYDVT  +SF N+ + W + IE  + + +  KM++GNK D + +R V+
Sbjct: 80  SSYYRGAHGIILVYDVTKRESFTNLADVWAKEIELHSTNKECIKMLVGNKVDKNEERMVT 139

Query: 418 KERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +E G   A E    F+E+SAK   NVE  F
Sbjct: 140 REEGLAFAQESGCLFLESSAKTRENVEKCF 169


>08_02_1318 -
           26111031-26111276,26112139-26112427,26112936-26113036,
           26113628-26113878,26114842-26114865,26115793-26116129
          Length = 415

 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 39/75 (52%), Positives = 62/75 (82%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           +T + LFK+++IGDS VGK+++L R++ + FN+   +TIG++F+ +++D++GK VK QIW
Sbjct: 8   ETEEYLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIW 67

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERFR +T+AY
Sbjct: 68  DTAGQERFRAVTSAY 82



 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEE--------NASADVEKMILGNKCDLDSQRQ 411
           RG+ G +LVYD++   +F+N+  W++ +          ++   V KM++GNKCDLD+ R+
Sbjct: 84  RGAFGALLVYDISRRSTFDNVGRWLQELNRCMTLIWKAHSDTTVAKMLVGNKCDLDNIRE 143

Query: 412 VSKERGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           V  E G+ LA    + F+ETSA DS NV  AF +
Sbjct: 144 VPVEEGKALAEAEGLFFMETSALDSTNVRTAFEI 177


>09_02_0222 +
           5968232-5968467,5970811-5971187,5972216-5972256,
           5972808-5972843
          Length = 229

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 39/78 (50%), Positives = 60/78 (76%)
 Frame = +2

Query: 20  KMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKL 199
           ++ +  D +FK++LIGDS VGK+ +L RF+ + FN+   +TIG++F+ RT+ +D + VK 
Sbjct: 10  EVGQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLHIDARTVKA 69

Query: 200 QIWDTAGQERFRTITTAY 253
           QIWDTAGQER+R +T+AY
Sbjct: 70  QIWDTAGQERYRAVTSAY 87



 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G MLVYD+T  +SF+++  W+  +  +A  ++  M++GNK DL + R V  E  ++
Sbjct: 89  RGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLGTLRVVPTEDAKE 148

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA +S NVE AF
Sbjct: 149 FAERENLFFMETSALESTNVENAF 172


>09_06_0029 + 20336634-20336881,20337737-20338208
          Length = 239

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 40/72 (55%), Positives = 57/72 (79%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D +FK++++GDS VGKT +L RF++D F +   STIG++F+ RT+ L  K+VK QIWDTA
Sbjct: 20  DYVFKVVVVGDSAVGKTQLLGRFTKDEFFLDSKSTIGVEFQTRTLSLHRKRVKAQIWDTA 79

Query: 218 GQERFRTITTAY 253
           GQER+R +T+AY
Sbjct: 80  GQERYRAVTSAY 91



 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDS-QRQVSKERGE 432
           RG++G M+VYD+T  ++FEN+  W+  +  +A       ++GNK D+ + +R+V+ +   
Sbjct: 93  RGALGAMVVYDITRRRTFENVARWVEELRAHADGSTVVALIGNKADMPAGRREVAADEAA 152

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAF 507
           + A E  + F E SA    NV+ AF
Sbjct: 153 RFAEEQGLFFSEASALSGDNVDRAF 177


>07_03_1397 +
           26269186-26269525,26269727-26269932,26270225-26270327,
           26270570-26270577
          Length = 218

 Score = 91.9 bits (218), Expect = 5e-19
 Identities = 39/75 (52%), Positives = 60/75 (80%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           ++ D LFK++L+GDS VGK+++L RF+ + F  +  STIG++F+ + + +DGK++K QIW
Sbjct: 9   QSQDYLFKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIW 68

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERFR +T+AY
Sbjct: 69  DTAGQERFRAVTSAY 83



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD++  ++F+++  W+  +  ++  +V  +++GNK DL   R+VS   G+ 
Sbjct: 85  RGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLKHAREVSTAEGKA 144

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA    + F+ETSA DS NV  AF
Sbjct: 145 LAESQGLFFMETSALDSSNVAEAF 168


>10_08_0250 -
           16179646-16179759,16180197-16180325,16180519-16180640,
           16181073-16181138,16182202-16182270,16182989-16183157
          Length = 222

 Score = 91.1 bits (216), Expect = 9e-19
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDA----FNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           ++C FK+LLIGDSGVGK+S+L  F   A     +     TIG+DFKI+ + + GKK+KL 
Sbjct: 16  HECSFKILLIGDSGVGKSSLLVSFVVAAAAAHLDDDIAPTIGVDFKIKFLTIGGKKLKLT 75

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 76  IWDTAGQERFRTITSSY 92



 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKN-WIRNIEENAS-ADVEKMILGNKCDLDSQRQVS 417
           +S  RG+ GI+LVYDVT  +SF N+   W + IE ++S  D  KM++GNK D + +R V+
Sbjct: 90  SSYYRGAQGIILVYDVTKRESFTNLAEVWSKEIESHSSNKDCIKMLVGNKIDKEDERTVT 149

Query: 418 KERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +E G   A E    F+E+SAK   NVE  F
Sbjct: 150 REEGLAFAEESGCLFLESSAKTRDNVEKCF 179


>02_04_0402 +
           22618998-22619043,22619206-22619345,22620067-22620149,
           22620234-22620438,22620524-22620592,22621099-22621188
          Length = 210

 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 41/93 (44%), Positives = 63/93 (67%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++ +W+ +  ++A+A++  M++GNKCDL  +R VS E 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTVMLIGNKCDLSHRRAVSYEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL*PGT 525
           GEQ A E+ + F+E SAK + NVE AF    GT
Sbjct: 134 GEQFAKEHGLVFMEASAKTAQNVEEAFIKTAGT 166



 Score = 85.0 bits (201), Expect = 6e-17
 Identities = 38/74 (51%), Positives = 53/74 (71%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +D K +KLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQESFRSITRSY 75


>05_01_0037 -
           256891-256998,257347-257502,257753-257824,258737-258784,
           259071-259143,259237-259250
          Length = 156

 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 42/88 (47%), Positives = 59/88 (67%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+ +SF N+K W+  I+  AS  V K+++GNKCDL   + V  E
Sbjct: 59  SSYYRGAHGIIIVYDVTDMESFNNVKQWLSEIDRYASDSVCKLLVGNKCDLVDSKVVDTE 118

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             +  A    I F+ETSAK+S+NVE AF
Sbjct: 119 EAKAFAESLGISFLETSAKESINVEEAF 146



 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 47/77 (61%), Positives = 54/77 (70%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M+  YD LFKLLLIGDS VGK+ +L RF+                KIRTI+LDGK VKLQ
Sbjct: 1   MSIEYDYLFKLLLIGDSSVGKSCLLLRFA----------------KIRTIELDGKTVKLQ 44

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 45  IWDTAGQERFRTITSSY 61


>03_06_0501 -
           34380155-34380637,34380961-34381029,34382206-34382229,
           34382622-34382786
          Length = 246

 Score = 87.8 bits (208), Expect = 8e-18
 Identities = 38/84 (45%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+T +++FENI+ W+R + ++A +++  M++GNK DL+  R V +E G+ 
Sbjct: 114 RGAVGALLVYDITKKQTFENIQRWLRELRDHADSNIVIMMVGNKSDLNHLRSVPEEDGQA 173

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  + F+ETSA ++LNVE AF
Sbjct: 174 LAEKEGLSFLETSALEALNVEKAF 197



 Score = 58.8 bits (136), Expect(2) = 2e-16
 Identities = 26/48 (54%), Positives = 37/48 (77%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           YD LFK++LIGDSGVGK++IL RF+ + F +   STIG++F  RT+ +
Sbjct: 9   YDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQI 56



 Score = 45.2 bits (102), Expect(2) = 2e-16
 Identities = 17/26 (65%), Positives = 23/26 (88%)
 Frame = +2

Query: 176 LDGKKVKLQIWDTAGQERFRTITTAY 253
           ++G+ +K QIWDTAGQER+R IT+AY
Sbjct: 87  IEGQTIKAQIWDTAGQERYRAITSAY 112


>03_06_0637 - 35219212-35219754,35220405-35220587
          Length = 241

 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 51/121 (42%), Positives = 77/121 (63%), Gaps = 25/121 (20%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI-------------- 172
           YD LFK++LIGDSGVGK+++L RF+ ++F++   STIG++F  RTI              
Sbjct: 15  YDYLFKIVLIGDSGVGKSNLLSRFTRNSFSLDSKSTIGVEFATRTIQYYCFPKGPLLNCF 74

Query: 173 ----DLDGKKVKLQIWDTAGQERFRTITTAY------SVVLWELCLSTML-RMRRALKTL 319
                ++GK VK QIWDTAGQER+R IT+AY      +++++++  +T    ++R LK L
Sbjct: 75  NFVTQVEGKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTKATTFENVKRWLKEL 134

Query: 320 R 322
           R
Sbjct: 135 R 135



 Score = 82.2 bits (194), Expect = 4e-16
 Identities = 37/84 (44%), Positives = 55/84 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYDVT   +FEN+K W++ + ++A +++  M++GNK DL   R VS E    
Sbjct: 107 RGAVGALLVYDVTKATTFENVKRWLKELRDHADSNIVVMLIGNKIDLKHLRSVSLEDATS 166

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + FVETSA D+ NV+ AF
Sbjct: 167 FAEREGLSFVETSALDATNVDKAF 190


>04_04_0191 +
           23468410-23468455,23468560-23468699,23469119-23469201,
           23469346-23469550,23469632-23469735,23470290-23470449
          Length = 245

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 38/87 (43%), Positives = 60/87 (68%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++ +W+ +  ++A+A++  M++GNK DL  +R VS E 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLVGNKSDLSHRRAVSYEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E+ + F+E SAK + NVE AF
Sbjct: 134 GEQFAKEHGLIFMEASAKTAQNVEEAF 160



 Score = 83.8 bits (198), Expect = 1e-16
 Identities = 38/74 (51%), Positives = 53/74 (71%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +D + VKLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITVDSRPVKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQESFRSITRSY 75


>07_03_0473 -
           18525712-18525858,18526049-18526162,18526442-18526522,
           18526787-18526865,18526902-18526996,18527092-18527170,
           18527339-18527450,18527682-18527770,18527868-18527938,
           18528846-18528962
          Length = 327

 Score = 83.0 bits (196), Expect = 2e-16
 Identities = 36/69 (52%), Positives = 53/69 (76%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+ +GD  VGKTSI+ RF  D F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 10  YKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 69

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 70  RFRSLIPSY 78



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQR 408
           S +R S   ++V+DV + +SF N   WI  +     +DV  +++GNK DL  +R
Sbjct: 77  SYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKR 130



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 22/53 (41%), Positives = 27/53 (50%)
 Frame = +1

Query: 349 ASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           AS  V K  L   C     RQVS E GE  A +  + F+ETSAK   N++  F
Sbjct: 230 ASVPVLKANLVLSCTFSCNRQVSIEEGEGKAKDLGVMFIETSAKAGFNIKALF 282


>07_01_0685 -
           5177340-5177363,5177770-5177865,5177991-5178053,
           5178138-5178232,5178941-5179028,5179372-5179444,
           5179866-5179920,5180355-5180463
          Length = 200

 Score = 81.4 bits (192), Expect = 7e-16
 Identities = 40/89 (44%), Positives = 61/89 (68%), Gaps = 4/89 (4%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFE----NIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSK 420
           L G    + ++D   ++ F     +I+NWIRNIE++AS +V K+++GNK D+D++R VS 
Sbjct: 85  LDGKRVKLQIWDTAGQERFRTITTDIRNWIRNIEQHASDNVNKILVGNKVDMDTKRVVST 144

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +G++LA EY +KF ETSAK + NVE  F
Sbjct: 145 AQGQKLADEYGMKFFETSAKTNQNVEQVF 173



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +2

Query: 59  LIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRT 238
           +I + G+ K+ I        + +S +S   +   +RT++LDGK+VKLQIWDTAGQERFRT
Sbjct: 46  VITNMGIPKSDIAIPQGTSDYLLSNLSDDHMIDLVRTVELDGKRVKLQIWDTAGQERFRT 105

Query: 239 ITT 247
           ITT
Sbjct: 106 ITT 108


>10_03_0038 -
           7297210-7297248,7297361-7297429,7297524-7297731,
           7297829-7297911,7298859-7298998,7299132-7299183
          Length = 196

 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 60/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFEN-IKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           S  RG+   +LVYD+T  ++F N + +W+ +  ++ASA +  +++GNKCDL  +R VS +
Sbjct: 76  SYYRGNAACLLVYDITRRETFFNHLASWLEDATQHASARMTIILIGNKCDLSHRRVVSYQ 135

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
            GEQ A E+ + F+E SAK + NVE AF L
Sbjct: 136 EGEQFAKEHGLLFMEASAKTAHNVEKAFIL 165



 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 36/77 (46%), Positives = 50/77 (64%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M+ TY   FK + IGD+GVGK+ +L +F++  F      T G+++    + +DGK  KLQ
Sbjct: 1   MSCTYAYRFKFVTIGDAGVGKSCLLLQFTDKRFREVEDLTTGVEYGACVVAVDGKNTKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQE FR IT +Y
Sbjct: 61  IWDTAGQEAFRCITRSY 77


>10_06_0181 - 11532765-11533203,11536867-11537036
          Length = 202

 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/84 (40%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+T  +SF++I  W+  +  +A  ++  M++GNK DL+ +R VS E  ++
Sbjct: 67  RGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLEDERAVSTEDAKE 126

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA  + NVE AF
Sbjct: 127 FAEKENLFFLETSALQATNVENAF 150



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/50 (50%), Positives = 38/50 (76%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK 187
           D +FK++LIGDS VGK+ IL RF+ + F+I   +TIG++F+ RT+ +D K
Sbjct: 8   DYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLLIDHK 57


>01_01_0893 +
           7043130-7043182,7043309-7043335,7043461-7043560,
           7045110-7045256,7045342-7045422,7045509-7045654,
           7046030-7046099
          Length = 207

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 33/77 (42%), Positives = 52/77 (67%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA     L K++++GDSGVGKTS++ ++    F+  + +TIG DF  + + +D +   LQ
Sbjct: 1   MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERF+++  A+
Sbjct: 61  IWDTAGQERFQSLGVAF 77



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 37/91 (40%), Positives = 53/91 (58%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS-ADVEK---MILGNKCDLD--SQRQVS 417
           RG+   +LVYDV   KSFE + +W       AS +D E    ++LGNK D+D  + R VS
Sbjct: 79  RGADCCVLVYDVNVTKSFERLNSWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRTVS 138

Query: 418 KERGEQ-LAIEYQIKFVETSAKDSLNVEYAF 507
           +++ +   A +  I + ETSAK+  NVE AF
Sbjct: 139 EKKAKAWCASKGNIPYFETSAKEGFNVEAAF 169


>03_01_0365 -
           2839190-2839251,2839637-2839694,2839946-2840032,
           2840117-2840206,2840575-2840650,2840877-2840971,
           2841090-2841173,2841270-2841343,2841803-2841827
          Length = 216

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 28/86 (32%), Positives = 54/86 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+T+ +SF   + W++ ++++ S D+  +++GNK DL   R VS +  ++
Sbjct: 93  RGAAAAVVVYDITSPESFSKAQYWVKELQKHGSPDIIMVLVGNKADLHENRHVSSQEAQE 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFSL 513
            A +  + F+ETSAK + N+   F +
Sbjct: 153 YAEKNNMVFIETSAKTADNINQVFEV 178



 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 1/65 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWDT 214
           D   KL+L+GDSGVGK+ I+ RF    F+ +   T+G  F  +T+ L D   VK +IWDT
Sbjct: 29  DLRAKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTLALEDSTIVKFEIWDT 88

Query: 215 AGQER 229
           AGQER
Sbjct: 89  AGQER 93


>12_02_1213 +
           27058329-27058370,27058634-27058711,27058807-27058974,
           27059834-27059882,27060084-27060157,27060692-27060785,
           27060924-27061003,27061311-27061322
          Length = 198

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 30/84 (35%), Positives = 47/84 (55%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TN  SF   K W++ ++   + +    + GNK D+   RQV  E  + 
Sbjct: 82  RGAAAAIVVYDITNAASFTRAKKWVQELQAQGNPNTIMALAGNKADMVEARQVPAEEAKT 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK ++NV   F
Sbjct: 142 YAQENGLFFMETSAKTAINVNDVF 165



 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 30/68 (44%), Positives = 45/68 (66%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+L+GD G GK+S++ RF +  F     STIG  F  +T+ ++ + VK +IWDTAGQER
Sbjct: 13  KLVLLGDVGTGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETVKFEIWDTAGQER 72

Query: 230 FRTITTAY 253
           + ++   Y
Sbjct: 73  YHSLAPMY 80


>03_05_0601 +
           26039326-26039367,26039958-26040035,26040136-26040303,
           26040994-26041042,26041502-26041575,26041940-26041948
          Length = 139

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 30/68 (44%), Positives = 45/68 (66%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+L+GD G GK+S++ RF +  F     STIG  F  +T+ ++ + VK +IWDTAGQER
Sbjct: 13  KLVLLGDVGAGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETVKFEIWDTAGQER 72

Query: 230 FRTITTAY 253
           + ++   Y
Sbjct: 73  YHSLAPMY 80



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           RG+   ++VYD+TN  SF   K W++ ++   ++     + GNK DL   RQV  E
Sbjct: 82  RGAAAAIVVYDITNPASFTRAKKWVQELQAQGNSSTVVALAGNKADLLETRQVQIE 137


>05_03_0590 -
           15884485-15884489,15884702-15884790,15885086-15885251,
           15885333-15885393,15886256-15886392,15887936-15888002
          Length = 174

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 27/69 (39%), Positives = 43/69 (62%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+L+GD  VGKTS++ R+  D F+    +T+   +  + + ++G  + L IWDTAGQE
Sbjct: 15  FKLVLLGDGRVGKTSLVLRYVNDVFSDKQEATVQASYLTKRLVVEGVPITLSIWDTAGQE 74

Query: 227 RFRTITTAY 253
           +F  +   Y
Sbjct: 75  KFHALGPIY 83



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/85 (25%), Positives = 39/85 (45%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +   +LVYD+T+  +F  +  W++ +++ A+ D+   I  NK DL   + +       
Sbjct: 85  RDADAALLVYDITDNDTFLRVTKWVKELKQMANKDIVMAIAANKSDLVRSKHIDTNEAAS 144

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A         TSAK    ++  FS
Sbjct: 145 YAESIGATLFVTSAKAGTGIDDIFS 169


>03_01_0647 +
           4745788-4745907,4746510-4746591,4746847-4746958,
           4747607-4747697,4747805-4747969
          Length = 189

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 35/104 (33%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +1

Query: 199 TNMGYCWSREIPYNNNSILRGSMGIMLVYDVTN-EKSFENIKNWIRNIEENASADVEKMI 375
           T  GY W+ E+P  +  +     G     D     +SF +I  WI  +      DV  ++
Sbjct: 38  TYQGYSWAGEVPELDPKL---HQGFFCGSDCLRYRQSFLSISKWIEEVNTQRGGDVIIVL 94

Query: 376 LGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +GNK DL  +RQ+S + GE  A E+   F+ETSAK   N++  F
Sbjct: 95  VGNKTDLVDKRQISTDEGEAKAQEHGAMFMETSAKAGFNIKPLF 138



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISF 133
           +KL+ +GD  VGKT+I+ RF  D F+ ++
Sbjct: 11  YKLVFLGDQAVGKTAIITRFMYDKFDATY 39


>10_08_0165 +
           15356748-15356811,15357113-15357186,15357311-15357394,
           15357508-15357602,15357737-15357790,15357791-15357896,
           15358236-15358277,15358585-15358674,15358788-15358984,
           15359355-15359413,15360166-15362252
          Length = 983

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 1/60 (1%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWDTAGQE 226
           KL+L+GDSGVGK+ I+ RF    F+ +   T+G  F  +T+ L D   VK +IWDTAGQE
Sbjct: 46  KLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTLALEDSTTVKFEIWDTAGQE 105



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 14/100 (14%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIR--------------NIEENASADVEKMILGNKCD 393
           RG+   ++VYD+T+ +SF   + W++               ++++ S D+   ++GNK D
Sbjct: 134 RGAGAAIVVYDITSSESFNKAQYWVKMYVDHGLHLTSINHELQKHGSPDMIMALVGNKAD 193

Query: 394 LDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           L   R VS +  ++ A    + F+ETSAK + N+   F +
Sbjct: 194 LHDNRSVSSQDAQEYAERNTMFFIETSAKTADNINQLFEV 233


>06_03_1187 +
           28267535-28267568,28267620-28267645,28267808-28267975,
           28268148-28268196,28268329-28268402,28268512-28268841
          Length = 226

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 26/84 (30%), Positives = 47/84 (55%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+++  S+   + W+  ++   +  +   ++GNK DL+ +RQV  +   +
Sbjct: 62  RGAAAAVVVYDISSTDSYIRARKWVDELQRQGNPHLVMALVGNKVDLEEKRQVGTQEAME 121

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSAK S NV   F
Sbjct: 122 YAERNGLFFIETSAKTSQNVTELF 145



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/39 (48%), Positives = 25/39 (64%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           STIG  F  + + +D   VKL IWDTAGQER+ ++   Y
Sbjct: 22  STIGAAFFSQVLIMDEATVKLDIWDTAGQERYHSLAPMY 60


>05_06_0080 +
           25420371-25420423,25420681-25420780,25421742-25421888,
           25421959-25422039,25422147-25422296
          Length = 176

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 38/91 (41%), Positives = 55/91 (60%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS-ADVEK---MILGNKCDLD--SQRQVS 417
           RG+   +LVYDV + KSF+N+ NW       AS +D +    ++LGNK D+D  + R VS
Sbjct: 70  RGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVS 129

Query: 418 KERGEQ-LAIEYQIKFVETSAKDSLNVEYAF 507
           +++ +   A +  I + ETSAKD  NVE AF
Sbjct: 130 EKKAKAWCASKGNIPYFETSAKDGTNVEEAF 160



 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 27/77 (35%), Positives = 43/77 (55%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA     L K++++GDSG         +    F+  + +TIG DF  + +  + +   LQ
Sbjct: 1   MASRRRTLLKVIILGDSG---------YVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ 51

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERF+++  A+
Sbjct: 52  IWDTAGQERFQSLGVAF 68


>06_03_0668 +
           23301578-23301791,23302102-23302199,23302233-23302301,
           23302674-23302961,23303045-23303208,23303344-23303599,
           23303706-23303816,23304109-23304195,23305916-23305985,
           23306093-23306149,23306309-23306426,23307314-23307403,
           23307492-23307671,23307816-23307893,23308016-23308088
          Length = 650

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 26/71 (36%), Positives = 38/71 (53%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+L+GD G GKT+ + R     F   +  TIG++ +         KV+   WDTAGQE
Sbjct: 442 FKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFHTSRGKVRFCCWDTAGQE 501

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 502 KFGGLRDGYYI 512


>05_07_0205 -
           28402436-28402505,28402604-28402681,28402789-28402968,
           28403051-28403140,28403258-28403375,28403461-28403517,
           28404155-28404224,28404317-28404319
          Length = 221

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+++GD G GKT+ + R     F   +  TIG++        +  K++   WDTAGQE
Sbjct: 14  FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCGKIRFYCWDTAGQE 73

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 74  KFGGLRDGYYI 84



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+  W R++      ++  ++ GNK D+   RQV K +      +  
Sbjct: 90  IIMFDVTSRLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDV-KNRQV-KAKQVTFHRKKN 146

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ E SAK + N E  F
Sbjct: 147 LQYYEISAKSNYNFEKPF 164


>01_05_0673 +
           24183512-24183514,24183625-24183694,24184203-24184259,
           24184348-24184465,24185044-24185133,24185209-24185388,
           24185474-24185551,24185642-24185711
          Length = 221

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+++GD G GKT+ + R     F   +  TIG++        +  K++   WDTAGQE
Sbjct: 14  FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQE 73

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 74  KFGGLRDGYYI 84



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+  W R++      ++  ++ GNK D+   RQV K +      +  
Sbjct: 90  IIMFDVTSRLTYKNVPTWHRDL-CRVCENIPIVLCGNKVDV-KNRQV-KAKQVTFHRKKN 146

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ E SAK + N E  F
Sbjct: 147 LQYYEVSAKSNYNFEKPF 164


>06_01_0907 +
           7001946-7002050,7002389-7002476,7002606-7002679,
           7002829-7002892,7004355-7004419,7004557-7004622,
           7004725-7004757,7004968-7005045,7005295-7005303
          Length = 193

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA +     K + +GD  VGKT +L  ++ + F   ++ T+  +F    + +DG  V L 
Sbjct: 1   MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVV-VDGTTVNLG 59

Query: 203 IWDTAGQERFRTI 241
           +WDTAGQE +  +
Sbjct: 60  LWDTAGQEDYNRL 72


>05_06_0217 +
           26457847-26457902,26458336-26458435,26458551-26458697,
           26459040-26459120,26459251-26459396,26459509-26459572
          Length = 197

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK----MILGNKCDLD--SQRQVS 417
           RG+   MLVYDV  ++SF  +  W       AS    K    ++LGNK D+D  ++R + 
Sbjct: 71  RGADCCMLVYDVNAKRSFNALNTWHDEFLTQASPSDPKHFPFILLGNKIDIDAGNRRAIP 130

Query: 418 KERGEQLAI-EYQIKFVETSAKDSLNVEYAF 507
           +++ ++  + +  I + ETSAKD  NV+ AF
Sbjct: 131 EKKAKEWCVSKGNIPYFETSAKDDYNVDSAF 161



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 26/70 (37%), Positives = 43/70 (61%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDSG         +    F+  + +TIG DF  + + ++ + V LQIWDTAGQ
Sbjct: 9   LLKVIVLGDSG---------YVNKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWDTAGQ 59

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 60  ERFQSLGVAF 69


>02_05_1357 +
           35899480-35899578,35900247-35900334,35900438-35900592,
           35900652-35900715,35902910-35902974,35903061-35903126,
           35903644-35903745
          Length = 212

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 22/64 (34%), Positives = 37/64 (57%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K + +GD  VGKT +L  ++ + F   ++ T+  +F    + +DG  V L +WDTAGQE 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQED 66

Query: 230 FRTI 241
           +  +
Sbjct: 67  YNRL 70


>02_02_0624 -
           12323702-12323777,12324219-12324304,12324360-12324425,
           12324650-12324762,12324793-12324856,12324950-12325059,
           12325473-12325560,12325651-12325749
          Length = 233

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 22/64 (34%), Positives = 37/64 (57%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K + +GD  VGKT +L  ++ + F   ++ T+  +F    + +DG  V L +WDTAGQE 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGNTVNLGLWDTAGQED 66

Query: 230 FRTI 241
           +  +
Sbjct: 67  YNRL 70


>02_01_0155 -
           1080923-1081024,1081111-1081176,1081306-1081370,
           1081938-1082001,1082359-1082507,1082591-1082678,
           1083757-1083855
          Length = 210

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 22/64 (34%), Positives = 37/64 (57%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K + +GD  VGKT +L  ++ + F   ++ T+  +F    + +DG  V L +WDTAGQE 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGNTVNLGLWDTAGQED 66

Query: 230 FRTI 241
           +  +
Sbjct: 67  YNRL 70


>02_05_0708 -
           31103246-31103359,31104146-31104178,31104297-31104362,
           31104532-31104596,31105456-31105519,31105629-31105738,
           31105886-31105973,31106328-31106432
          Length = 214

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA +     K + +GD  VGKT +L  ++ + F   +I T+  +F    + +D   V L 
Sbjct: 1   MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVV-VDSTTVNLG 59

Query: 203 IWDTAGQERFRTI 241
           +WDTAGQE +  +
Sbjct: 60  LWDTAGQEDYNRL 72


>05_06_0061 +
           25274693-25274794,25274982-25275069,25275186-25275295,
           25275542-25275605,25275713-25275777,25275864-25275929,
           25276084-25276199,25276382-25276415
          Length = 214

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K + +GD  VGKT +L  ++ + F   +I T+  +F    + +DG  V L +WDTAGQE 
Sbjct: 9   KCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSAN-VSVDGNIVNLGLWDTAGQED 67

Query: 230 F 232
           +
Sbjct: 68  Y 68


>07_03_0638 +
           20196216-20196650,20196810-20196930,20197072-20197168,
           20197284-20197323,20197648-20197731,20198966-20199130
          Length = 313

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ L+GD  +GKTS + ++  D    + +   G++   +T+ + G ++   IWD AG  +
Sbjct: 130 KVSLLGDCQIGKTSFMVKYVGDDEEQNGLQMTGLNLMDKTLAVRGARIAFSIWDVAGDSQ 189

Query: 230 F 232
           F
Sbjct: 190 F 190


>07_01_0842 +
           6840943-6841288,6841800-6841970,6842762-6842832,
           6843068-6843187,6843654-6843772,6844045-6844126,
           6844254-6844259
          Length = 304

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 142 RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 196

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 197 IRPLWRHY 204


>05_05_0295 -
           23912502-23912507,23912631-23912712,23913020-23913138,
           23913480-23913599,23913927-23913997,23914525-23914672
          Length = 181

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>03_06_0420 +
           33794045-33794192,33794831-33794901,33795093-33795212,
           33795466-33795584,33795775-33795856,33795984-33795989
          Length = 181

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>01_06_1108 +
           34574299-34574446,34575000-34575070,34575246-34575365,
           34575471-34575488,34575708-34575826,34576244-34576325,
           34576537-34576542
          Length = 187

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>01_01_1138 -
           9019049-9019159,9019525-9019606,9020059-9020177,
           9020977-9021096,9021313-9021383,9021801-9021948
          Length = 216

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>06_01_0098 +
           818374-818427,818537-818627,818753-818868,818962-819087,
           819175-819357
          Length = 189

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L++G    GKT+IL+R       +S I TIG  F +  ++   K V   +WD  GQ++
Sbjct: 18  KVLMLGLDAAGKTTILYRLHIGEV-LSSIPTIG--FNVEKVEY--KNVAFTVWDVGGQDK 72

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 73  LRPLWRQY 80


>03_02_0046 -
           5255513-5255630,5255715-5255876,5256579-5256733,
           5256811-5256892,5257790-5257827
          Length = 184

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +L LIG    GKTS++   +   F+   I T+G  F +R +      +KL  WD  GQ R
Sbjct: 21  ELSLIGLQNAGKTSLVNVIATGGFSEDMIPTVG--FNMRKVTKGNVTIKL--WDLGGQPR 76

Query: 230 FRTITTAY 253
           FR++   Y
Sbjct: 77  FRSMWERY 84


>02_01_0226 +
           1476529-1476585,1477207-1477297,1478247-1478362,
           1478834-1478893,1479000-1479065,1479847-1480047
          Length = 196

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +++++G    GKT+IL+R       +S + T+G  F +  +    K V   +WD  GQE+
Sbjct: 19  RVVMLGLDAAGKTTILYRLHMGEV-LSTVPTVG--FNVEKVQY--KNVVFTVWDVGGQEK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  LRPLWKMY 81


>02_02_0711 -
           13180406-13180423,13180483-13180563,13181026-13181188,
           13182096-13182206,13182365-13182429
          Length = 145

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +2

Query: 2   GTRIVVKMAKTYDCLFKLLLIGDSGVGKTSILFRFS-EDAFNISFISTIGIDFKIRTIDL 178
           G   +++  K  +   ++L++G    GKT+I+ + + ED   IS   T+G  F I+TI  
Sbjct: 2   GLLSIIRKIKRKEKEMRILMVGLDNSGKTTIVLKINGEDTGVIS--PTLG--FNIKTIKY 57

Query: 179 DGKKVKLQIWDTAGQERFRTITTAY 253
              K  L IWD  GQ+  R+    Y
Sbjct: 58  H--KYSLNIWDIGGQKTIRSYWRNY 80


>01_01_0909 -
           7163886-7163931,7164148-7164254,7164370-7164435,
           7164720-7164784,7164937-7165000,7165685-7165794,
           7165972-7166059,7166100-7166297
          Length = 247

 Score = 32.7 bits (71), Expect(2) = 0.026
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +2

Query: 122 NISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERF 232
           ++ +I T+  +F    + +DG  V L +WDTAGQE +
Sbjct: 65  DLDYIPTVFDNFSAN-VSVDGSVVNLGLWDTAGQEDY 100



 Score = 22.6 bits (46), Expect(2) = 0.026
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAF 121
           K + +GD  VGKT +L  ++ + F
Sbjct: 12  KCVTVGDGAVGKTCMLICYTCNKF 35


>02_05_0413 +
           28773869-28773925,28774045-28774135,28774515-28774630,
           28775627-28775686,28775767-28775832,28776499-28776693
          Length = 194

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +++++G    GKT+IL++       +S + TIG  F +  +    K V   +WD  GQE+
Sbjct: 19  RVVMLGLDAAGKTTILYKLHIGEV-LSTVPTIG--FNVEKVQY--KNVMFTVWDVGGQEK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  LRPLWRHY 81


>10_08_1062 +
           22626262-22626318,22626404-22626494,22626601-22626716,
           22627035-22627094,22627204-22627269,22627726-22627914
          Length = 192

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +++++G    GKT+IL++       +S + TIG  F +  +    K V   +WD  GQE+
Sbjct: 19  RVVMLGLDAAGKTTILYKLHIGEV-LSTVPTIG--FNVEKVQY--KNVVFTVWDVGGQEK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  LRPLWRHY 81


>02_05_0639 -
           30552148-30552265,30552362-30552523,30553177-30553298,
           30553515-30553596,30554407-30554699
          Length = 258

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 110 EDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           ++A   S ++ + + F +R +      +KL  WD  GQ RFRT+   Y
Sbjct: 113 QNAGKTSLVNAVAVGFNMRKVTKGNVTIKL--WDLGGQRRFRTMWERY 158


>08_01_0921 +
           9075409-9075511,9075606-9075689,9075744-9075806,
           9077163-9077181,9078227-9078338,9078902-9078949,
           9079372-9079502,9079673-9079757,9079776-9079784
          Length = 217

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 12/80 (15%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFS--------EDAF----NISFISTIGIDFKIRTIDLDGKKV 193
           ++L++G    GKT+IL+R             F    ++ F     I F + T+  +   +
Sbjct: 19  RILVLGLDNAGKTTILYRLQMGEVVSTIPSGFPAPDSLIFFLPFAIGFNVETVQYN--NI 76

Query: 194 KLQIWDTAGQERFRTITTAY 253
           K Q+WD  GQ   R     Y
Sbjct: 77  KFQVWDLGGQTSIRPYWRCY 96


>07_03_1468 - 26739872-26740912
          Length = 346

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = +1

Query: 586 PQADAERRSQAGDVAVALQRALTPSAHYDPRPSPILTLWYFELPTLTIFS 735
           P+ DA   S   D+ V   R L     Y P PSP   + YF     T+FS
Sbjct: 54  PRPDAAGVSST-DITVDASRGLWARVFYSPSPSPRPVVVYFHGGGFTLFS 102


>11_03_0182 +
           11307275-11307368,11307485-11307594,11307654-11307856,
           11307879-11307964,11308861-11308934,11308936-11309078,
           11309485-11309594,11309645-11309787
          Length = 320

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +2

Query: 125 ISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERF 232
           + +I T+  +F    + +DG  + L +W TAGQE +
Sbjct: 2   LDYIPTVFDNFSAN-VSVDGNIINLGLWGTAGQEDY 36


>12_01_0957 +
           9531045-9531069,9531904-9531971,9532659-9532882,
           9533299-9533380,9533513-9533572,9533717-9533795,
           9533935-9534082,9534237-9534312,9534603-9534776,
           9535908-9536058,9536264-9536292,9536388-9536536,
           9536652-9536754,9537043-9537098,9537209-9537332,
           9537547-9537609,9537707-9537766,9537942-9538103,
           9538262-9538332,9538500-9538593,9538675-9538811,
           9538915-9538995,9539402-9539524,9539585-9539693
          Length = 815

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -2

Query: 636 RDSHVTGLRASFSVGLWTPLLPPDGLLASCFF 541
           RD+H +  R S   G WTPLL   G+ ++ +F
Sbjct: 462 RDAHRSSCRNSSRRGWWTPLLFTAGVASAKYF 493


>11_01_0773 +
           6461854-6461961,6462225-6462483,6462727-6462958,
           6463070-6463220,6463334-6463408,6463607-6463669
          Length = 295

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 5/57 (8%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFEN-----IKNWIRNIEENASADVEKMILGNKCDLDSQRQVS 417
           S+G++++   T EK+F N      KN+I N+  N +  V   +     D +  +Q+S
Sbjct: 221 SLGLLIIEITTGEKNFPNREDIIAKNFIENVRRNRTNIVHISLKYPSLDTNCLQQIS 277


>07_03_1298 -
           25592788-25592890,25593126-25593229,25593747-25593808,
           25593957-25594065,25594215-25594355,25594707-25594769,
           25594974-25595084,25596140-25596457
          Length = 336

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 6/75 (8%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFS------EDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           F ++++G    GKT++L +        E   +   + T+G++       ++   VKL  W
Sbjct: 151 FHVVILGVHKAGKTTLLEKVKSIYLKEEGLPHDRIVPTVGLNIG----RIEDANVKLVFW 206

Query: 209 DTAGQERFRTITTAY 253
           D  GQ   RTI   Y
Sbjct: 207 DLGGQPGLRTIWEKY 221


>01_01_0018 + 139150-140415
          Length = 421

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 610 SQAGDVAVALQRALTPSAHYDP 675
           S  GD+ VA Q +L PS H++P
Sbjct: 282 SSIGDINVANQASLAPSEHFNP 303


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,438,177
Number of Sequences: 37544
Number of extensions: 432238
Number of successful extensions: 1495
Number of sequences better than 10.0: 71
Number of HSP's better than 10.0 without gapping: 1376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1470
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2039640244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -