SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0673 + 24183512-24183514,24183625-24183694,24184203-241842...   188   6e-48
05_07_0205 - 28402436-28402505,28402604-28402681,28402789-284029...   187   7e-48
06_03_0668 + 23301578-23301791,23302102-23302199,23302233-233023...   182   4e-46
05_07_0127 - 27872803-27873238,27873842-27874059                       59   3e-09
07_03_0473 - 18525712-18525858,18526049-18526162,18526442-185265...    57   1e-08
09_02_0464 - 9591139-9591571,9592601-9592818                           54   1e-07
01_06_0186 + 27294973-27295211,27295610-27296045                       54   1e-07
05_01_0036 + 253734-253904,255216-255707                               54   2e-07
02_05_0708 - 31103246-31103359,31104146-31104178,31104297-311043...    53   2e-07
01_05_0340 - 21139885-21139978,21140169-21140272,21140379-211405...    53   2e-07
09_06_0029 + 20336634-20336881,20337737-20338208                       52   7e-07
05_06_0082 - 25425050-25425479,25426551-25426783                       52   7e-07
01_06_1343 - 36461476-36461961,36463355-36463519                       51   9e-07
01_06_0712 + 31397167-31397402,31399823-31400252                       51   9e-07
09_02_0222 + 5968232-5968467,5970811-5971187,5972216-5972256,597...    51   1e-06
06_03_0414 - 20548577-20549006,20553521-20553744                       51   1e-06
02_05_0161 + 26384079-26384086,26386173-26386226,26386376-263864...    50   2e-06
01_01_0565 - 4159946-4160042,4160140-4160243,4160378-4160533,416...    50   2e-06
05_06_0061 + 25274693-25274794,25274982-25275069,25275186-252752...    50   3e-06
05_03_0286 - 11623575-11624063,11625098-11625262                       46   3e-05
10_06_0181 - 11532765-11533203,11536867-11537036                       45   6e-05
06_03_1387 - 29820358-29821035                                         45   6e-05
01_01_0893 + 7043130-7043182,7043309-7043335,7043461-7043560,704...    45   6e-05
03_06_0637 - 35219212-35219754,35220405-35220587                       44   1e-04
10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731,729...    44   1e-04
07_03_1397 + 26269186-26269525,26269727-26269932,26270225-262703...    44   2e-04
02_04_0402 + 22618998-22619043,22619206-22619345,22620067-226201...    43   2e-04
04_04_0191 + 23468410-23468455,23468560-23468699,23469119-234692...    43   3e-04
02_02_0624 - 12323702-12323777,12324219-12324304,12324360-123244...    43   3e-04
08_02_1318 - 26111031-26111276,26112139-26112427,26112936-261130...    42   5e-04
02_01_0155 - 1080923-1081024,1081111-1081176,1081306-1081370,108...    41   0.001
05_03_0590 - 15884485-15884489,15884702-15884790,15885086-158852...    40   0.002
01_01_0909 - 7163886-7163931,7164148-7164254,7164370-7164435,716...    40   0.003
12_02_1213 + 27058329-27058370,27058634-27058711,27058807-270589...    39   0.005
02_05_1357 + 35899480-35899578,35900247-35900334,35900438-359005...    39   0.005
06_01_0907 + 7001946-7002050,7002389-7002476,7002606-7002679,700...    38   0.009
03_01_0326 + 2535800-2535938,2536891-2536959,2537310-2537375,253...    38   0.012
07_03_0638 + 20196216-20196650,20196810-20196930,20197072-201971...    37   0.015
05_06_0217 + 26457847-26457902,26458336-26458435,26458551-264586...    37   0.020
05_06_0080 + 25420371-25420423,25420681-25420780,25421742-254218...    37   0.020
03_05_0601 + 26039326-26039367,26039958-26040035,26040136-260403...    36   0.027
03_06_0501 - 34380155-34380637,34380961-34381029,34382206-343822...    36   0.036
03_01_0365 - 2839190-2839251,2839637-2839694,2839946-2840032,284...    36   0.047
07_01_0926 - 7775536-7775616,7775695-7775787,7775903-7775965,777...    34   0.11 
03_06_0475 + 34193951-34194023,34195414-34195486,34195572-341956...    34   0.11 
05_01_0037 - 256891-256998,257347-257502,257753-257824,258737-25...    34   0.14 
10_08_0250 - 16179646-16179759,16180197-16180325,16180519-161806...    33   0.19 
03_06_0407 - 33714563-33714636,33714966-33715152,33715943-337160...    33   0.33 
10_08_0165 + 15356748-15356811,15357113-15357186,15357311-153573...    32   0.44 
06_03_1187 + 28267535-28267568,28267620-28267645,28267808-282679...    32   0.58 
12_02_0413 - 18803875-18803938,18804009-18804787                       30   1.8  
02_05_0473 + 29319824-29322511,29322659-29322820,29324133-293242...    30   2.3  
05_05_0118 - 22504483-22504566,22504650-22504742,22504852-225049...    29   3.1  
04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479...    29   3.1  
02_02_0464 - 10552347-10552466,10552683-10552928,10553866-105541...    29   4.1  
12_02_0679 - 21870084-21870689,21870780-21870977                       29   5.4  
11_06_0031 + 19425011-19425113,19425552-19425637,19425732-194258...    29   5.4  
09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443,404...    29   5.4  
07_01_0685 - 5177340-5177363,5177770-5177865,5177991-5178053,517...    29   5.4  
03_02_0046 - 5255513-5255630,5255715-5255876,5256579-5256733,525...    29   5.4  
02_05_1169 + 34656450-34656603,34657321-34657481,34657907-346579...    29   5.4  
12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425...    28   7.1  
12_02_0233 - 16023062-16023253,16023528-16023609,16023699-160238...    28   7.1  
12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449...    28   7.1  
11_06_0706 + 26460400-26462254,26462499-26462562,26462929-264629...    28   7.1  
11_06_0697 + 26371193-26371397,26371562-26374254                       28   7.1  
11_06_0578 + 25176304-25176388,25176503-25177032,25177267-251779...    28   7.1  
11_06_0211 + 21305535-21305895,21306512-21306761,21307543-213076...    28   7.1  
11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730...    28   7.1  
11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917...    28   7.1  
11_02_0004 + 7260084-7260967,7261284-7263264,7263359-7263420,726...    28   7.1  
10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375...    28   7.1  
10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138...    28   7.1  
09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155...    28   7.1  
09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469...    28   7.1  
08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695...    28   7.1  
08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870...    28   7.1  
08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387...    28   7.1  
06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999...    28   7.1  
06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978...    28   7.1  
05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516...    28   7.1  
05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506...    28   7.1  
04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053...    28   7.1  
04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463,871...    28   7.1  
04_01_0171 - 1927238-1928728,1928819-1929016                           28   7.1  
03_04_0018 - 16484109-16484300,16484575-16484656,16484746-164848...    28   7.1  
02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270...    28   7.1  
01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019...    28   7.1  
01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881...    28   7.1  
09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763...    28   9.4  
04_04_1106 - 30948626-30948724,30948841-30949176,30949231-309493...    28   9.4  

>01_05_0673 +
           24183512-24183514,24183625-24183694,24184203-24184259,
           24184348-24184465,24185044-24185133,24185209-24185388,
           24185474-24185551,24185642-24185711
          Length = 221

 Score =  188 bits (457), Expect = 6e-48
 Identities = 87/136 (63%), Positives = 98/136 (72%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D P+FK V+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+    C   
Sbjct: 10  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L            +MFDVTSR+TYKNVP WHRDL RVCE IPIVLCGNKVD+
Sbjct: 70  AGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
           K+R+VKAK + FHRKK
Sbjct: 130 KNRQVKAKQVTFHRKK 145



 Score =  127 bits (306), Expect = 1e-29
 Identities = 71/133 (53%), Positives = 84/133 (63%), Gaps = 2/133 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           IRF  WDTAGQEKFGGLRDGYYI GQCAI    V   L+ Y    T        C    P
Sbjct: 62  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLT-YKNVPTWHRDLCRVCE-NIP 119

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY++SAKSNYNFEKPFL+LARKL GDGNL F
Sbjct: 120 IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHF 179

Query: 610 VAMPALLPPEVTM 648
           V  PAL PP+VT+
Sbjct: 180 VETPALAPPDVTI 192


>05_07_0205 -
           28402436-28402505,28402604-28402681,28402789-28402968,
           28403051-28403140,28403258-28403375,28403461-28403517,
           28404155-28404224,28404317-28404319
          Length = 221

 Score =  187 bits (456), Expect = 7e-48
 Identities = 87/136 (63%), Positives = 98/136 (72%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D P+FK V+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+    C   
Sbjct: 10  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCGKIRFYCWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L            +MFDVTSR+TYKNVP WHRDL RVCE IPIVLCGNKVD+
Sbjct: 70  AGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
           K+R+VKAK + FHRKK
Sbjct: 130 KNRQVKAKQVTFHRKK 145



 Score =  121 bits (291), Expect = 7e-28
 Identities = 72/145 (49%), Positives = 87/145 (60%), Gaps = 2/145 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           IRF  WDTAGQEKFGGLRDGYYI GQCAI    V   L+ Y    T        C    P
Sbjct: 62  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLT-YKNVPTWHRDLCRVCE-NIP 119

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY+ISAKSNYNFEKPFL+LARKL GD NL F
Sbjct: 120 IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHF 179

Query: 610 VAMPALLPPEVTMGSSMAEPN*KDL 684
           V   AL PPEV +  +M + +  +L
Sbjct: 180 VEAVALKPPEVPIDLAMQQQHEAEL 204


>06_03_0668 +
           23301578-23301791,23302102-23302199,23302233-23302301,
           23302674-23302961,23303045-23303208,23303344-23303599,
           23303706-23303816,23304109-23304195,23305916-23305985,
           23306093-23306149,23306309-23306426,23307314-23307403,
           23307492-23307671,23307816-23307893,23308016-23308088
          Length = 650

 Score =  182 bits (442), Expect = 4e-46
 Identities = 81/134 (60%), Positives = 99/134 (73%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPD 286
           P+FK +LVGDGGTGKTTFVKRH+TGEFEK+Y  T+GVEV PL FHT+RG+    C     
Sbjct: 440 PSFKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFHTSRGKVRFCCWDTAG 499

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKD 466
           +     L        +   +MFDVTSR+TYKNVP WH+D+ RVC+ IPIVLCGNKVD+K+
Sbjct: 500 QEKFGGLRDGYYIHGHCAIIMFDVTSRLTYKNVPTWHKDICRVCDNIPIVLCGNKVDMKN 559

Query: 467 RKVKAKTIVFHRKK 508
           R+VKAK + FHRKK
Sbjct: 560 RQVKAKMVTFHRKK 573



 Score =  113 bits (273), Expect = 1e-25
 Identities = 68/133 (51%), Positives = 81/133 (60%), Gaps = 2/133 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           +RF  WDTAGQEKFGGLRDGYYI G CAI    V   L+ Y    T        C    P
Sbjct: 490 VRFCCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTSRLT-YKNVPTWHKDICRVCD-NIP 547

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY+ISAKSNYNFEKPFL+LARKL GD NL F
Sbjct: 548 IVLCGNKVDMKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLTGDMNLRF 607

Query: 610 VAMPALLPPEVTM 648
           V   ALLP +VT+
Sbjct: 608 VEELALLPADVTI 620


>05_07_0127 - 27872803-27873238,27873842-27874059
          Length = 217

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 39/120 (32%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE      H  ++     +  T   +
Sbjct: 13  FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V   V++DVT  VT++NV  W R+L       I I+L GNK D++
Sbjct: 73  RYRAI--TSAYYRGAVGALVVYDVTRHVTFENVERWMRELKDHTDANIVIMLVGNKADLR 130


>07_03_0473 -
           18525712-18525858,18526049-18526162,18526442-18526522,
           18526787-18526865,18526902-18526996,18527092-18527170,
           18527339-18527450,18527682-18527770,18527868-18527938,
           18528846-18528962
          Length = 327

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           +K V +GD   GKT+ + R +  +F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 10  YKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I   +V  ++FDV SR ++ N   W  + VR   G  + IVL GNK D+ 
Sbjct: 70  RFRSLIPS-YIRDSSVAVIVFDVASRQSFLNTSKWIEE-VRTERGSDVIIVLVGNKTDLV 127

Query: 464 DRK 472
           D++
Sbjct: 128 DKR 130


>09_02_0464 - 9591139-9591571,9592601-9592818
          Length = 216

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE         ++     +  T   +
Sbjct: 13  FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V   V++DVT  VT++NV  W ++L       I I+L GNK D++
Sbjct: 73  RYRAI--TSAYYRGAVGALVVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLR 130


>01_06_0186 + 27294973-27295211,27295610-27296045
          Length = 224

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE     V   +R     +  T   +
Sbjct: 20  FKVVLIGDSGVGKSNLLSRFARDEFSLETRSTIGVEFATKTVRVDDRLVKAQIWDTAGQE 79

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V   V++DVT R+T++N   W ++L       I ++L GNK D++
Sbjct: 80  RYRAI--TSAYYRGAVGALVVYDVTRRITFENAERWLKELRDHTDANIVVMLVGNKADLR 137


>05_01_0036 + 253734-253904,255216-255707
          Length = 220

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 4/127 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE      H   G+ +   +  T   
Sbjct: 15  FKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLHV-EGKIIKAQIWDTAGQ 73

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           +R   +  T   ++  + +V+ +DV+   T+ N+  W ++L    +  I I+L GNK D+
Sbjct: 74  ERYRAI--TSAYYRGALGAVLVYDVSKPTTFDNISRWLKELRDHADANIRIMLVGNKTDL 131

Query: 461 KDRKVKA 481
           K  +  A
Sbjct: 132 KHLRAVA 138


>02_05_0708 -
           31103246-31103359,31104146-31104178,31104297-31104362,
           31104532-31104596,31105456-31105519,31105629-31105738,
           31105886-31105973,31106328-31106432
          Length = 214

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 4/131 (3%)
 Frame = +2

Query: 92  MADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFV 262
           MA     F KCV VGDG  GKT  +  + + +F   Y+ T+      + +V  T     +
Sbjct: 1   MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGL 60

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVL 439
                Q D   L  L   +    +V  + F + SR +Y+N+   W  +L     G+PIVL
Sbjct: 61  WDTAGQEDYNRLRPL---SYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVL 117

Query: 440 CGNKVDIKDRK 472
            G K+D+++ K
Sbjct: 118 VGTKLDLREDK 128


>01_05_0340 -
           21139885-21139978,21140169-21140272,21140379-21140534,
           21140622-21140693,21140782-21140829,21140923-21140970,
           21141807-21141879,21142333-21142346
          Length = 202

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++DVT + ++ NV  W  ++ R   E +  +L GNK D+ + 
Sbjct: 69  RFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAEN 128

Query: 470 KV 475
           +V
Sbjct: 129 RV 130


>09_06_0029 + 20336634-20336881,20337737-20338208
          Length = 239

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 4/120 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK V+VGD   GKT  + R    EF     +T+GVE     L  H  R +   +  T   
Sbjct: 23  FKVVVVGDSAVGKTQLLGRFTKDEFFLDSKSTIGVEFQTRTLSLHRKRVK-AQIWDTAGQ 81

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDI 460
           +R   V  T   ++  +   V++D+T R T++NV  W  +L    +G  +V L GNK D+
Sbjct: 82  ERYRAV--TSAYYRGALGAMVVYDITRRRTFENVARWVEELRAHADGSTVVALIGNKADM 139


>05_06_0082 - 25425050-25425479,25426551-25426783
          Length = 220

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 37/121 (30%), Positives = 60/121 (49%), Gaps = 4/121 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE        + G+ +   +  T   
Sbjct: 18  FKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLQVD-GKVIKAQIWDTAGQ 76

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +DVT R T+ NV  W R+L       I  +L GNK D+
Sbjct: 77  ERYRAI--TSAYYRGAVGALLVYDVTRRATFDNVGRWLRELRDHTDPSIVCMLIGNKSDL 134

Query: 461 K 463
           +
Sbjct: 135 R 135


>01_06_1343 - 36461476-36461961,36463355-36463519
          Length = 216

 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE                +  T   +
Sbjct: 13  FKIVLIGDSGVGKSNILSRFTRNEFFLESKSTIGVEFATRTLQIEGKTIKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           R   +  T   ++  V +++ FD+T R T+ NV  W R+L    +  I +++ GNK D+
Sbjct: 73  RYRAI--TSAYYRGAVGALLVFDITKRQTFDNVQRWLRELRDHADANIVVMMVGNKSDL 129


>01_06_0712 + 31397167-31397402,31399823-31400252
          Length = 221

 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 37/121 (30%), Positives = 61/121 (50%), Gaps = 4/121 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE        + G+ V   +  T   
Sbjct: 19  FKTVLIGDSGVGKSNLLSRFTKNEFCLESKSTIGVEFATRSIQVD-GKVVKAQIWDTAGQ 77

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +DVT R T+ NV  W ++L       I ++L GNK D+
Sbjct: 78  ERYRAI--TSAYYRGAVGALLVYDVTRRATFDNVARWLKELRDHTDPSIVVMLVGNKSDL 135

Query: 461 K 463
           +
Sbjct: 136 R 136


>09_02_0222 +
           5968232-5968467,5970811-5971187,5972216-5972256,
           5972808-5972843
          Length = 229

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF     AT+GVE      H + R     +  T   +
Sbjct: 19  FKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLHIDARTVKAQIWDTAGQE 78

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   +++D+T R ++ +V  W  +L     + I I+L GNK D+ 
Sbjct: 79  RYRAV--TSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLG 136

Query: 464 DRKV 475
             +V
Sbjct: 137 TLRV 140


>06_03_0414 - 20548577-20549006,20553521-20553744
          Length = 217

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 36/121 (29%), Positives = 61/121 (50%), Gaps = 4/121 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE        + G+ V   +  T   
Sbjct: 15  FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVD-GKVVKAQIWDTAGQ 73

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +DVT   T++NV  W ++L       I ++L GNK D+
Sbjct: 74  ERYRAI--TSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDL 131

Query: 461 K 463
           +
Sbjct: 132 R 132


>02_05_0161 +
           26384079-26384086,26386173-26386226,26386376-26386448,
           26386775-26386822,26386906-26386953,26387990-26388061,
           26388156-26388311,26388428-26388531,26388628-26388724
          Length = 219

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     +   Y++T+GV+        +     L       + 
Sbjct: 25  FKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 84

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + +++DVT + ++ NV  W  ++ R   + +  +L GNK D+   
Sbjct: 85  RFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTAN 144

Query: 470 KV 475
           KV
Sbjct: 145 KV 146


>01_01_0565 -
           4159946-4160042,4160140-4160243,4160378-4160533,
           4160629-4160700,4161796-4161843,4161923-4161970,
           4162295-4162367,4163188-4163201
          Length = 203

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     +   Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + +++DVT + ++ NV  W  ++ R   + +  +L GNK D+   
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTAN 128

Query: 470 KV 475
           KV
Sbjct: 129 KV 130


>05_06_0061 +
           25274693-25274794,25274982-25275069,25275186-25275295,
           25275542-25275605,25275713-25275777,25275864-25275929,
           25276084-25276199,25276382-25276415
          Length = 214

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQPDKR 292
           KCV VGDG  GKT  +  + + +F   Y+ T+       V  +  G  V L       + 
Sbjct: 9   KCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANV--SVDGNIVNLGLWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               L   +    ++  + F + SR +Y+NV   W  +L R    +PIVL G K+D++D 
Sbjct: 67  DYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDH 126

Query: 470 K 472
           +
Sbjct: 127 R 127



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 45  SANVSVDGNIVNLGLWDTAGQEDYSRLR 72


>05_03_0286 - 11623575-11624063,11625098-11625262
          Length = 217

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R     F     +T+GVE                +  T   +
Sbjct: 13  FKMVLIGDSGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKTIKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           R   +  T   ++  V +++ +D+T R ++ NV  W R+L       I I++ GNK D+
Sbjct: 73  RYRAI--TSAYYRGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVIMMVGNKSDL 129



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           G    + S+  E + I+  +WDTAGQE++  +   YY
Sbjct: 46  GVEFATKSLQMEGKTIKAQIWDTAGQERYRAITSAYY 82


>10_06_0181 - 11532765-11533203,11536867-11537036
          Length = 202

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD   GK+  + R    EF     AT+GVE     F T     +L+     D +
Sbjct: 11  FKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVE-----FQTRT---LLI-----DHK 57

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD 466
              V  T   ++  + +++ +D+T R ++ ++P W  +L     + I I+L GNK D++D
Sbjct: 58  YRAV--TSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLED 115

Query: 467 RK 472
            +
Sbjct: 116 ER 117


>06_03_1387 - 29820358-29821035
          Length = 225

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLM 268
           M ++   FK V++GD   GKT  + R    EF     +T+G+E           +    +
Sbjct: 1   MEEEDYVFKVVVIGDSAVGKTQLLGRFTKDEFFIDSKSTIGIEFQTRTVEIGGKRVKAQI 60

Query: 269 CGTQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLC 442
             T   +R   V  T   ++  +   +++DVTSR ++ +   W  DL       I ++L 
Sbjct: 61  WDTAGQERYRAV--TSAYYRGALGAMLVYDVTSRRSFHHAARWLHDLRAHADNSIVVMLI 118

Query: 443 GNKVDIKDRKVKA 481
           GNK D+   +  A
Sbjct: 119 GNKADLSHARAVA 131


>01_01_0893 +
           7043130-7043182,7043309-7043335,7043461-7043560,
           7045110-7045256,7045342-7045422,7045509-7045654,
           7046030-7046099
          Length = 207

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F  +Y AT+G +        +   F L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV    +++ + +W  + L++      E  P V+ GNK+D+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNVTKSFERLNSWREEFLIQASPSDPENFPFVVLGNKIDV 129


>03_06_0637 - 35219212-35219754,35220405-35220587
          Length = 241

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 19/136 (13%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCG---T 277
           FK VL+GD G GK+  + R     F     +T+GVE     + ++      +L C    T
Sbjct: 19  FKIVLIGDSGVGKSNLLSRFTRNSFSLDSKSTIGVEFATRTIQYYCFPKGPLLNCFNFVT 78

Query: 278 QPDKRSLVVLETDTIFKDNVLSV-------------MFDVTSRVTYKNVPNWHRDLVRVC 418
           Q + + +     DT  ++   ++             ++DVT   T++NV  W ++L    
Sbjct: 79  QVEGKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTKATTFENVKRWLKELRDHA 138

Query: 419 EG-IPIVLCGNKVDIK 463
           +  I ++L GNK+D+K
Sbjct: 139 DSNIVVMLIGNKIDLK 154



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 244 EPRAIRFNVWDTAGQEKFGGLRDGYY 321
           E + ++  +WDTAGQE++  +   YY
Sbjct: 81  EGKIVKAQIWDTAGQERYRAITSAYY 106


>10_03_0038 -
           7297210-7297248,7297361-7297429,7297524-7297731,
           7297829-7297911,7298859-7298998,7299132-7299183
          Length = 196

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK V +GD G GK+  + +     F +    T GVE    V   +     L       + 
Sbjct: 9   FKFVTIGDAGVGKSCLLLQFTDKRFREVEDLTTGVEYGACVVAVDGKNTKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKN-VPNWHRDLVRVCEG-IPIVLCGNKVDIK 463
           +   + T + ++ N   ++ +D+T R T+ N + +W  D  +     + I+L GNK D+ 
Sbjct: 69  AFRCI-TRSYYRGNAACLLVYDITRRETFFNHLASWLEDATQHASARMTIILIGNKCDLS 127

Query: 464 DRKV 475
            R+V
Sbjct: 128 HRRV 131



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 8/149 (5%)
 Frame = +1

Query: 175 DWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCA---IS 345
           D R RE     +G    +  +  + +  +  +WDTAGQE F  +   YY +G  A   + 
Sbjct: 30  DKRFREVEDLTTGVEYGACVVAVDGKNTKLQIWDTAGQEAFRCITRSYY-RGNAACLLVY 88

Query: 346 HVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQY 519
            + R  + +    + L         R    L+  +    + R  S  E   F +E  L +
Sbjct: 89  DITRRETFFNHLASWLEDATQHASARMTIILIGNKCDLSHRRVVSYQEGEQFAKEHGLLF 148

Query: 520 YDISAKSNYNFEKPFLWLAR---KLIGDG 597
            + SAK+ +N EK F+  AR   K I DG
Sbjct: 149 MEASAKTAHNVEKAFILAARTVHKKIEDG 177


>07_03_1397 +
           26269186-26269525,26269727-26269932,26270225-26270327,
           26270570-26270577
          Length = 218

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF     +T+GVE        +  +    +  T   +
Sbjct: 15  FKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAGQE 74

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   V  T   ++  V +++ +D++ R T+ +V  W  +L    +  +  +L GNK D+K
Sbjct: 75  RFRAV--TSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK 132


>02_04_0402 +
           22618998-22619043,22619206-22619345,22620067-22620149,
           22620234-22620438,22620524-22620592,22621099-22621188
          Length = 210

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 27/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +     L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           S   + T + ++    +++ +D+T R T+ ++ +W  D  +     + ++L GNK D+  
Sbjct: 67  SFRSI-TRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTVMLIGNKCDLSH 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDNKPIKLQIWDTAGQESFRSITRSYY 76


>04_04_0191 +
           23468410-23468455,23468560-23468699,23469119-23469201,
           23469346-23469550,23469632-23469735,23470290-23470449
          Length = 245

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +     L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITVDSRPVKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           S   + T + ++    +++ +D+T R T+ ++ +W  D  +     + I+L GNK D+  
Sbjct: 67  SFRSI-TRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLVGNKSDLSH 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + R ++  +WDTAGQE F  +   YY
Sbjct: 48  ITVDSRPVKLQIWDTAGQESFRSITRSYY 76


>02_02_0624 -
           12323702-12323777,12324219-12324304,12324360-12324425,
           12324650-12324762,12324793-12324856,12324950-12325059,
           12325473-12325560,12325651-12325749
          Length = 233

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 3/125 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L   +    +V  + F + S+ +Y+N+   W  +L      +PIVL G K++ K 
Sbjct: 68  NRLRPL---SYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKLEEKT 124

Query: 467 RKVKA 481
              K+
Sbjct: 125 LATKS 129



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 44  SANVVVDGNTVNLGLWDTAGQEDYNRLR 71


>08_02_1318 -
           26111031-26111276,26112139-26112427,26112936-26113036,
           26113628-26113878,26114842-26114865,26115793-26116129
          Length = 415

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 2/102 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPDK 289
           FK V++GD   GK+  + R+   EF     AT+GVE        N +     +  T   +
Sbjct: 14  FKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVR 412
           R   V  T   ++    +++ +D++ R T+ NV  W ++L R
Sbjct: 74  RFRAV--TSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNR 113


>02_01_0155 -
           1080923-1081024,1081111-1081176,1081306-1081370,
           1081938-1082001,1082359-1082507,1082591-1082678,
           1083757-1083855
          Length = 210

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 16/135 (11%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP--------------NWHRDLVRVCEGI 427
             L  L   +    +V  + F + S+ +Y+NV               +W  +L     G+
Sbjct: 68  NRLRPL---SYRGADVFLLAFSLISKASYENVSKKARDSLSFSVNNIDWIPELKHYAPGV 124

Query: 428 PIVLCGNKVDIKDRK 472
           PI+L G K+D++D K
Sbjct: 125 PIILVGTKLDLRDDK 139



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 44  SANVVVDGNTVNLGLWDTAGQEDYNRLR 71


>05_03_0590 -
           15884485-15884489,15884702-15884790,15885086-15885251,
           15885333-15885393,15886256-15886392,15887936-15888002
          Length = 174

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 28/118 (23%), Positives = 49/118 (41%), Gaps = 1/118 (0%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK VL+GDG  GKT+ V R++   F  K  AT+                 L       +
Sbjct: 14  SFKLVLLGDGRVGKTSLVLRYVNDVFSDKQEATVQASYLTKRLVVEGVPITLSIWDTAGQ 73

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
                L        +   +++D+T   T+  V  W ++L ++  + I + +  NK D+
Sbjct: 74  EKFHALGPIYYRDADAALLVYDITDNDTFLRVTKWVKELKQMANKDIVMAIAANKSDL 131



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           I  ++WDTAGQEKF  L   YY     A+
Sbjct: 63  ITLSIWDTAGQEKFHALGPIYYRDADAAL 91


>01_01_0909 -
           7163886-7163931,7164148-7164254,7164370-7164435,
           7164720-7164784,7164937-7165000,7165685-7165794,
           7165972-7166059,7166100-7166297
          Length = 247

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 332 NVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
           +V  + F + SR +Y+NV   W  +L R   G+P+VL G K+D+++
Sbjct: 112 DVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLVGTKLDLRE 157



 Score = 28.7 bits (61), Expect = 5.4
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 77  SANVSVDGSVVNLGLWDTAGQEDYSRLR 104


>12_02_1213 +
           27058329-27058370,27058634-27058711,27058807-27058974,
           27059834-27059882,27060084-27060157,27060692-27060785,
           27060924-27061003,27061311-27061322
          Length = 198

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD GTGK++ V R + G+F +   +T+G          N             +  
Sbjct: 13  KLVLLGDVGTGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETVKFEIWDTAGQER 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIP---IVLCGNKVD-IK 463
              L            V++D+T+  ++     W ++L    +G P   + L GNK D ++
Sbjct: 73  YHSLAPMYYRGAAAAIVVYDITNAASFTRAKKWVQEL--QAQGNPNTIMALAGNKADMVE 130

Query: 464 DRKVKAK 484
            R+V A+
Sbjct: 131 ARQVPAE 137



 Score = 35.9 bits (79), Expect = 0.036
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S ++      ++F +WDTAGQE++  L   YY     AI
Sbjct: 45  GAAFFSQTLAVNDETVKFEIWDTAGQERYHSLAPMYYRGAAAAI 88


>02_05_1357 +
           35899480-35899578,35900247-35900334,35900438-35900592,
           35900652-35900715,35902910-35902974,35903061-35903126,
           35903644-35903745
          Length = 212

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 36/137 (26%), Positives = 57/137 (41%), Gaps = 18/137 (13%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V  +     +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP----------------NWHRDLVRVCE 421
             L  L   +    +V  + F + S+ +Y+NV                  W  +L     
Sbjct: 68  NRLRPL---SYRGADVFLLAFSLISKASYENVSKKAIKSCRPLSLLSLHEWIPELRHYAP 124

Query: 422 GIPIVLCGNKVDIKDRK 472
           G+PI+L G K+D++D K
Sbjct: 125 GVPIILVGTKLDLRDDK 141



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 44  SANVVVDGSTVNLGLWDTAGQEDYNRLR 71


>06_01_0907 +
           7001946-7002050,7002389-7002476,7002606-7002679,
           7002829-7002892,7004355-7004419,7004557-7004622,
           7004725-7004757,7004968-7005045,7005295-7005303
          Length = 193

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 39/128 (30%), Positives = 56/128 (43%), Gaps = 1/128 (0%)
 Frame = +2

Query: 92  MADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM 268
           MA     F KCV VGDG  GKT  +  + + +F   YV        P VF  N    V++
Sbjct: 1   MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYV--------PTVF-DNFSANVVV 51

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGN 448
            GT     +L + +T      N L  +    + V       W  +L     G+PIVL G 
Sbjct: 52  DGTTV---NLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLWLPELQHYAPGVPIVLVGT 108

Query: 449 KVDIKDRK 472
           K+D+++ K
Sbjct: 109 KLDLREDK 116



 Score = 28.3 bits (60), Expect = 7.1
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 46  SANVVVDGTTVNLGLWDTAGQEDYNRLR 73


>03_01_0326 +
           2535800-2535938,2536891-2536959,2537310-2537375,
           2537979-2538100,2538501-2538629,2540462-2540569
          Length = 210

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 7/120 (5%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRR-----NLSSYVQKCT*LA*RFG 408
           + ++  +WDTAGQE+F G+   YY    G   +  V +     NL+    K   L     
Sbjct: 60  KKLKLTIWDTAGQERFRGITSSYYRGAHGIILVYDVTKRESFTNLADVWAKEIELHSTNK 119

Query: 409 PCM*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLI 588
            C+       V K     R  +  E   F QE    + + SAK+  N EK F  LA K++
Sbjct: 120 ECIKMLVGNKVDKNEE--RMVTREEGLAFAQESGCLFLESSAKTRENVEKCFEELALKIL 177



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 24/126 (19%), Positives = 56/126 (44%), Gaps = 4/126 (3%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLT-GEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPD 286
           +FK +L+GD   GK++ +   ++    + +   T+GV+        N  +  L       
Sbjct: 12  SFKILLIGDSAVGKSSLLVSFVSASHIDDEIAPTIGVDFKIKFLTVNGKKLKLTIWDTAG 71

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIV--LCGNKVD 457
           +     + +      + + +++DVT R ++ N+ + W +++         +  L GNKVD
Sbjct: 72  QERFRGITSSYYRGAHGIILVYDVTKRESFTNLADVWAKEIELHSTNKECIKMLVGNKVD 131

Query: 458 IKDRKV 475
             + ++
Sbjct: 132 KNEERM 137


>07_03_0638 +
           20196216-20196650,20196810-20196930,20197072-20197168,
           20197284-20197323,20197648-20197731,20198966-20199130
          Length = 313

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +D+ + K  L+GD   GKT+F+ +++  + E+  +   G+ +        RG  +     
Sbjct: 124 EDVVSLKVSLLGDCQIGKTSFMVKYVGDDEEQNGLQMTGLNLMDKTLAV-RGARIAFSIW 182

Query: 278 QPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKV 454
                S  +       KD V +  MFD+TSR T  NV +W+    +  +    +L G K 
Sbjct: 183 DVAGDSQFLDHVPIACKDAVAILYMFDLTSRCTLTNVIDWYERARKWNKTAIPILIGTKF 242

Query: 455 D 457
           D
Sbjct: 243 D 243


>05_06_0217 +
           26457847-26457902,26458336-26458435,26458551-26458697,
           26459040-26459120,26459251-26459396,26459509-26459572
          Length = 197

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 30/141 (21%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +1

Query: 190 EKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI----SHVRR 357
           ++ +   G    +  +  E R +   +WDTAGQE+F  L   +Y    C +     + +R
Sbjct: 27  QQYKATIGADFVTKEVLIEDRLVTLQIWDTAGQERFQSLGVAFYRGADCCMLVYDVNAKR 86

Query: 358 NLSSYVQKCT*LA*RFGPCM*R-YPYCLVRKQ----SGY*R--QKS*GENYCFPQEKDLQ 516
           + ++          +  P   + +P+ L+  +    +G  R   +   + +C   + ++ 
Sbjct: 87  SFNALNTWHDEFLTQASPSDPKHFPFILLGNKIDIDAGNRRAIPEKKAKEWCV-SKGNIP 145

Query: 517 YYDISAKSNYNFEKPFLWLAR 579
           Y++ SAK +YN +  FL +A+
Sbjct: 146 YFETSAKDDYNVDSAFLCIAK 166


>05_06_0080 +
           25420371-25420423,25420681-25420780,25421742-25421888,
           25421959-25422039,25422147-25422296
          Length = 176

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    +  + +E R     +WDTAGQE+F  L   +Y    C +
Sbjct: 33  GADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCV 76



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 27/120 (22%), Positives = 49/120 (40%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G         ++  +F  +Y AT+G +            F L       +  
Sbjct: 10  KVIILGDSG---------YVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQER 60

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV S  ++ N+ NW  + L++      +  P VL GNKVD+
Sbjct: 61  FQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDV 120


>03_05_0601 +
           26039326-26039367,26039958-26040035,26040136-26040303,
           26040994-26041042,26041502-26041575,26041940-26041948
          Length = 139

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 27/120 (22%), Positives = 48/120 (40%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD G GK++ V R + G+F +   +T+G          N             +  
Sbjct: 13  KLVLLGDVGAGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETVKFEIWDTAGQER 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIKDRK 472
              L            V++D+T+  ++     W ++L        +V L GNK D+ + +
Sbjct: 73  YHSLAPMYYRGAAAAIVVYDITNPASFTRAKKWVQELQAQGNSSTVVALAGNKADLLETR 132



 Score = 35.9 bits (79), Expect = 0.036
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S ++      ++F +WDTAGQE++  L   YY     AI
Sbjct: 45  GAAFFSQTLAVNDETVKFEIWDTAGQERYHSLAPMYYRGAAAAI 88


>03_06_0501 -
           34380155-34380637,34380961-34381029,34382206-34382229,
           34382622-34382786
          Length = 246

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE 220
           FK VL+GD G GK+  + R    EF  +  +T+GVE
Sbjct: 13  FKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVE 48



 Score = 32.7 bits (71), Expect = 0.33
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +1

Query: 244 EPRAIRFNVWDTAGQEKFGGLRDGYY 321
           E + I+  +WDTAGQE++  +   YY
Sbjct: 88  EGQTIKAQIWDTAGQERYRAITSAYY 113



 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +2

Query: 344 VMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +++D+T + T++N+  W R+L       I I++ GNK D+
Sbjct: 121 LVYDITKKQTFENIQRWLRELRDHADSNIVIMMVGNKSDL 160


>03_01_0365 -
           2839190-2839251,2839637-2839694,2839946-2840032,
           2840117-2840206,2840575-2840650,2840877-2840971,
           2841090-2841173,2841270-2841343,2841803-2841827
          Length = 216

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 4/123 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD G GK+  V R + G+F+     T+G              F+       D   
Sbjct: 33  KLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVG------------ASFLSQTLALEDSTI 80

Query: 296 LVVLETDTIFKDN---VLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIK 463
           +     DT  ++       V++D+TS  ++     W ++L +     I +VL GNK D+ 
Sbjct: 81  VKFEIWDTAGQERGAAAAVVVYDITSPESFSKAQYWVKELQKHGSPDIIMVLVGNKADLH 140

Query: 464 DRK 472
           + +
Sbjct: 141 ENR 143


>07_01_0926 -
           7775536-7775616,7775695-7775787,7775903-7775965,
           7776326-7776423,7776661-7776761,7776865-7776937,
           7778575-7778647
          Length = 193

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE 220
           K +L+GD G GK+  + R   G F   ++ T+G++
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGID 51



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKF 297
           +I  + + I+  +WDTAGQE+F
Sbjct: 56  TIELDGKRIKLQIWDTAGQERF 77


>03_06_0475 +
           34193951-34194023,34195414-34195486,34195572-34195672,
           34195912-34196009,34196326-34196388,34196534-34196626,
           34196697-34196774
          Length = 192

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE 220
           K +L+GD G GK+  + R   G F   ++ T+G++
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGID 51



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKF 297
           ++  + + I+  +WDTAGQE+F
Sbjct: 56  TVELDGKRIKLQIWDTAGQERF 77


>05_01_0037 -
           256891-256998,257347-257502,257753-257824,258737-258784,
           259071-259143,259237-259250
          Length = 156

 Score = 33.9 bits (74), Expect = 0.14
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           +I  + + ++  +WDTAGQE+F  +   YY
Sbjct: 33  TIELDGKTVKLQIWDTAGQERFRTITSSYY 62


>10_08_0250 -
           16179646-16179759,16180197-16180325,16180519-16180640,
           16181073-16181138,16182202-16182270,16182989-16183157
          Length = 222

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 29/129 (22%), Positives = 59/129 (45%), Gaps = 8/129 (6%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKT----TFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +FK +L+GD G GK+    +FV        +     T+GV+   + F T  G+ + +   
Sbjct: 19  SFKILLIGDSGVGKSSLLVSFVVAAAAAHLDDDIAPTIGVD-FKIKFLTIGGKKLKLTIW 77

Query: 278 QPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIV--LCG 445
               +      T + ++    + +++DVT R ++ N+   W +++         +  L G
Sbjct: 78  DTAGQERFRTITSSYYRGAQGIILVYDVTKRESFTNLAEVWSKEIESHSSNKDCIKMLVG 137

Query: 446 NKVDIKDRK 472
           NK+D +D +
Sbjct: 138 NKIDKEDER 146



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 7/120 (5%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRR-----NLSSYVQKCT*LA*RFG 408
           + ++  +WDTAGQE+F  +   YY   QG   +  V +     NL+    K         
Sbjct: 70  KKLKLTIWDTAGQERFRTITSSYYRGAQGIILVYDVTKRESFTNLAEVWSKEIESHSSNK 129

Query: 409 PCM*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLI 588
            C+       + K+    R  +  E   F +E    + + SAK+  N EK F  LA K++
Sbjct: 130 DCIKMLVGNKIDKEDE--RTVTREEGLAFAEESGCLFLESSAKTRDNVEKCFEELALKIM 187


>03_06_0407 -
           33714563-33714636,33714966-33715152,33715943-33716093,
           33716520-33716632,33717022-33717085,33717180-33717391,
           33717540-33717621,33717811-33717866,33718004-33718072,
           33718524-33718772,33718873-33719049,33719556-33719702,
           33719794-33719926,33720093-33720307
          Length = 642

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM-CGTQPDKR 292
           + V++GD GTGK++ V    T  F +     +     P  +  +R    ++   + P+ R
Sbjct: 17  RVVVIGDPGTGKSSLVVSVATEAFPENVPRVMPPTRLPADYFPDRVPITIVDTSSSPEHR 76

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKDR 469
           + ++ E       + + + +      T + +   W  +L R+    P+++ G K+D++D 
Sbjct: 77  AKLIAECQAA---DAVVLTYACDRPATLERLSTFWLPELRRLQLKAPVIVVGCKLDLRDE 133

Query: 470 K 472
           +
Sbjct: 134 Q 134


>10_08_0165 +
           15356748-15356811,15357113-15357186,15357311-15357394,
           15357508-15357602,15357737-15357790,15357791-15357896,
           15358236-15358277,15358585-15358674,15358788-15358984,
           15359355-15359413,15360166-15362252
          Length = 983

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLG 214
           K VL+GD G GK+  V R + G+F+     T+G
Sbjct: 46  KLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVG 78


>06_03_1187 +
           28267535-28267568,28267620-28267645,28267808-28267975,
           28268148-28268196,28268329-28268402,28268512-28268841
          Length = 226

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S  +  +   ++ ++WDTAGQE++  L   YY     A+
Sbjct: 25  GAAFFSQVLIMDEATVKLDIWDTAGQERYHSLAPMYYRGAAAAV 68


>12_02_0413 - 18803875-18803938,18804009-18804787
          Length = 280

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 4/42 (9%)
 Frame = +2

Query: 113 FKCV-LVGDGGTGKTTFVK---RHLTGEFEKKYVATLGVEVH 226
           FK V +VG GG GKTT  K   R + GEF      T+G   H
Sbjct: 176 FKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPH 217


>02_05_0473 +
           29319824-29322511,29322659-29322820,29324133-29324249,
           29324360-29324469,29324504-29324540,29324696-29324862,
           29325002-29325089,29325163-29325270
          Length = 1158

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +1

Query: 175 DWRVREKIRCDSGCRSTSSS---IPYEPRAIRFNVWDTAGQEKFG 300
           DW  +E+  C  GC+S SSS   +P +P  + F +    G E +G
Sbjct: 769 DWH-QEEFFCPKGCKSRSSSNSLLPLQPTQVDFVMSPPIGDEIWG 812


>05_05_0118 -
           22504483-22504566,22504650-22504742,22504852-22504914,
           22505048-22505145,22505378-22505478,22505581-22505653,
           22505872-22505910,22506946-22507018
          Length = 207

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKF 297
           +I  + + I+  +WDTAGQE+F
Sbjct: 69  TIELDGKRIKLQIWDTAGQERF 90


>04_01_0365 -
           4796780-4796971,4797246-4797327,4797417-4797527,
           4797608-4797859,4797945-4800115
          Length = 935

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW +W+++L
Sbjct: 85  IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRHWKSDL 126


>02_02_0464 -
           10552347-10552466,10552683-10552928,10553866-10554135,
           10554231-10554413,10554493-10554688,10554775-10555079,
           10555515-10555604,10555689-10555806,10555991-10556088,
           10556187-10556272,10557622-10557736
          Length = 608

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV 223
           V++G+ GTGKTTF+ R L G  +   V    V+V
Sbjct: 381 VMLGENGTGKTTFI-RMLAGRVKPDKVGDEEVDV 413


>12_02_0679 - 21870084-21870689,21870780-21870977
          Length = 267

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+   R     +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFPPR-----SEVRGRDYALKK--MGDRWRQWKSDL 213


>11_06_0031 +
           19425011-19425113,19425552-19425637,19425732-19425829,
           19425950-19426067,19426200-19426289,19426770-19427074,
           19427162-19427357,19427435-19427617,19427713-19427982,
           19428906-19429151,19429633-19429704,19430087-19430104
          Length = 594

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV 223
           V++G+ GTGKTTF+ R L G  +   V    +E+
Sbjct: 377 VMLGENGTGKTTFI-RMLAGLLKPDTVEGTEIEI 409


>09_02_0081 -
           4041364-4041555,4041830-4041911,4042192-4042443,
           4042529-4044001,4044222-4044733,4044824-4045021
          Length = 902

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNLCQKTF 174
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L +  F
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDLNRDYF 218


>07_01_0685 -
           5177340-5177363,5177770-5177865,5177991-5178053,
           5178138-5178232,5178941-5179028,5179372-5179444,
           5179866-5179920,5180355-5180463
          Length = 200

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 8/22 (36%), Positives = 16/22 (72%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKF 297
           ++  + + ++  +WDTAGQE+F
Sbjct: 82  TVELDGKRVKLQIWDTAGQERF 103


>03_02_0046 -
           5255513-5255630,5255715-5255876,5256579-5256733,
           5256811-5256892,5257790-5257827
          Length = 184

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 2/113 (1%)
 Frame = +2

Query: 125 LVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVV 304
           L+G    GKT+ V    TG F +  + T+G  +   V   N    +   G QP  RS+  
Sbjct: 24  LIGLQNAGKTSLVNVIATGGFSEDMIPTVGFNMRK-VTKGNVTIKLWDLGGQPRFRSMWE 82

Query: 305 LETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR--VCEGIPIVLCGNKVD 457
                +   + +  + D   R       +   DL+      GIP+++ GNK+D
Sbjct: 83  RYCRAV---SAIVYVVDAADRENMAIAKSELHDLLSKPSLTGIPLLVIGNKID 132


>02_05_1169 +
           34656450-34656603,34657321-34657481,34657907-34657958,
           34658289-34658425,34658775-34658861,34658939-34659226
          Length = 292

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 4/29 (13%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVK----RHLTG 181
           P  +C+L+G  G+GKTT +K    +H+ G
Sbjct: 39  PGSRCLLIGANGSGKTTLLKILAGKHMVG 67


>12_02_0756 +
           22839673-22839870,22839961-22842194,22842280-22842531,
           22842612-22842722,22842812-22842893,22843168-22843359
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PESEVRGRDYALKK--MGDRWRQWKSDL 213


>12_02_0233 -
           16023062-16023253,16023528-16023609,16023699-16023809,
           16023890-16024141,16024227-16024580,16024893-16025548,
           16025554-16026459,16026550-16026747
          Length = 916

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>12_02_0193 +
           15242068-15242265,15242356-15244589,15244675-15244926,
           15245007-15245117,15245207-15245288,15245563-15245754
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>11_06_0706 +
           26460400-26462254,26462499-26462562,26462929-26462981,
           26464400-26464401,26464528-26464598,26464938-26465020,
           26465065-26465126
          Length = 729

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 5/33 (15%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVK-----RHLTGEFEKK 196
           +K  +VG GG GKTT  +     R + G F KK
Sbjct: 195 YKLAIVGTGGVGKTTLAQKIYNDRKIKGSFNKK 227


>11_06_0697 + 26371193-26371397,26371562-26374254
          Length = 965

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 5/33 (15%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVK-----RHLTGEFEKK 196
           +K  +VG GG GKTT  +     R + G F KK
Sbjct: 146 YKLAIVGTGGVGKTTLAQKIYNDRKIKGSFNKK 178


>11_06_0578 +
           25176304-25176388,25176503-25177032,25177267-25177997,
           25178122-25178172,25178562-25178813,25178894-25179004,
           25179102-25179183,25179460-25179489
          Length = 623

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+   R     +   GR YA  +  +G RW  W+++L
Sbjct: 47  IKTLLWNELQKYFVYPPR-----SEVRGRDYALKK--MGDRWRQWKSDL 88


>11_06_0211 +
           21305535-21305895,21306512-21306761,21307543-21307652,
           21308836-21309067,21310233-21310603,21311434-21311507,
           21311727-21311880,21312251-21312434,21313066-21313291,
           21313704-21314135,21314399-21314456,21314748-21314829,
           21315350-21315421,21316594-21316737,21317379-21317457,
           21318023-21318105,21318198-21318252,21318488-21318778
          Length = 1085

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = +1

Query: 82  NNENGR*YAHIQVCIGRRWWYW 147
           NNE  R   HIQV    +WWYW
Sbjct: 762 NNERVR---HIQVLQPSKWWYW 780


>11_06_0069 +
           19770182-19770379,19770470-19772703,19772789-19773040,
           19773121-19773231,19773321-19773402,19773677-19773868
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>11_04_0270 -
           15590955-15591146,15591421-15591502,15591592-15591702,
           15591783-15592034,15592120-15594353,15594444-15594641
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>11_02_0004 +
           7260084-7260967,7261284-7263264,7263359-7263420,
           7263614-7263686
          Length = 999

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +2

Query: 98  DDMPTFKCVL---VGDGGTGKTTFVKR-HLTGEFEKKYVATLGVEVHP 229
           +  PT KC +   VG GG GKTT  ++ +L    E K  A L V   P
Sbjct: 194 ESTPTNKCSIISIVGQGGLGKTTLARQVYLRIRGEYKCSAFLSVSQRP 241


>10_07_0107 -
           12936839-12937030,12937305-12937386,12937476-12937586,
           12937667-12937918,12938004-12940237,12940328-12940525
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>10_01_0112 -
           1386762-1386953,1387228-1387309,1387399-1387509,
           1387590-1387841,1387927-1388348,1388430-1390160,
           1390251-1390448
          Length = 995

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>09_04_0487 -
           18014469-18014660,18014935-18015016,18015297-18015548,
           18015634-18017789
          Length = 893

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 85  IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 126


>09_02_0131 -
           4693828-4694019,4694107-4694199,4694294-4694375,
           4694465-4694575,4694656-4694907,4694993-4697196
          Length = 977

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 85  IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 126


>08_02_0450 -
           17266977-17267165,17268017-17268053,17268139-17269514,
           17285369-17286055,17286146-17286343
          Length = 828

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>08_02_0194 +
           14084828-14085025,14085116-14085788,14085855-14087082,
           14087435-14087686,14087767-14087877,14087967-14088048,
           14088323-14088514
          Length = 911

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>08_01_0440 +
           3875422-3875619,3875710-3876382,3876449-3877943,
           3878029-3878280,3878361-3878471,3878561-3878642,
           3878917-3879108
          Length = 1000

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>06_01_1169 +
           9996068-9996265,9996356-9998589,9998675-9998926,
           9999007-9999117,9999207-9999288,9999563-9999754
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>06_01_1155 +
           9777611-9777808,9777899-9780132,9780218-9780469,
           9780550-9780660,9780750-9780831,9781106-9781297
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>05_01_0577 +
           5159934-5160131,5160222-5162455,5162541-5162792,
           5162873-5162983,5163073-5163154,5163429-5163620
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>05_01_0571 -
           5067558-5067749,5068024-5068105,5068195-5068305,
           5068386-5068637,5068723-5070956,5071047-5071244
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>04_03_0709 +
           18902507-18902704,18902795-18905028,18905114-18905365,
           18905446-18905556,18905646-18905727,18906002-18906193
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>04_02_0026 +
           8708765-8710935,8711021-8711272,8711353-8711463,
           8711553-8711634,8711909-8712100
          Length = 935

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 85  IKTLLWNELQKYFVFP-----PGSEVGGRDYALKK--MGDRWRQWKSDL 126


>04_01_0171 - 1927238-1928728,1928819-1929016
          Length = 562

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>03_04_0018 -
           16484109-16484300,16484575-16484656,16484746-16484856,
           16484937-16485188,16485274-16485677,16486035-16486952,
           16486990-16487475,16487566-16487763
          Length = 880

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 167 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 208


>02_01_0374 -
           2702804-2702995,2703270-2703351,2703441-2703551,
           2703632-2703883,2703969-2704798,2704895-2706202,
           2706293-2706490
          Length = 990

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>01_06_0075 -
           26201231-26201422,26201697-26201778,26201868-26201978,
           26202059-26202310,26202396-26204629,26204720-26204917
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>01_05_0224 +
           19485296-19485493,19485584-19487817,19487903-19488154,
           19488235-19488345,19488435-19488516,19488791-19488982
          Length = 1022

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEVRGRDYALKK--MGDRWRQWKSDL 213


>09_02_0349 -
           7632140-7632234,7632348-7632449,7632864-7632962,
           7633517-7633622,7633897-7633978,7634068-7634178,
           7634259-7634510,7634596-7635688,7636157-7636829,
           7636920-7637117
          Length = 936

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 13  VTTLLWNELNLDFLIQSRIK*P*NNENGR*YAHIQVCIGRRWWYWQNNL 159
           + TLLWNEL   F+       P +   GR YA  +  +G RW  W+++L
Sbjct: 172 IKTLLWNELQKYFVFP-----PGSEIRGRDYALKK--MGDRWRQWKSDL 213


>04_04_1106 -
           30948626-30948724,30948841-30949176,30949231-30949353,
           30949425-30949517,30949603-30949806,30949884-30950134,
           30951011-30952391,30952737-30953174
          Length = 974

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 112 IQVCIGRRWWYWQNNLCQKTFD 177
           I  CIGR+W  W+  L QK +D
Sbjct: 703 IMKCIGRKWKSWKALLKQKHYD 724


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,414,456
Number of Sequences: 37544
Number of extensions: 489905
Number of successful extensions: 1841
Number of sequences better than 10.0: 91
Number of HSP's better than 10.0 without gapping: 1665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1801
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2063219900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -