SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0109 - 22454539-22456268,22457069-22457279                      190   8e-49
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    190   1e-48
03_06_0484 + 34233042-34233258,34235317-34237049                      186   1e-47
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   173   9e-44
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...   173   2e-43
08_01_0654 - 5639419-5641449                                          163   1e-40
05_04_0392 - 20889699-20891726                                        161   4e-40
05_04_0052 - 17515344-17517353                                        151   4e-37
03_02_0542 - 9348126-9349585,9352433-9352655                          129   2e-30
03_02_0540 + 9340379-9340592,9341250-9342988                          128   3e-30
03_02_0546 - 9381989-9383733,9385838-9386054                          121   5e-28
11_08_0075 + 28173220-28173433,28175348-28177083                      116   2e-26
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165    116   3e-26
12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231          114   8e-26
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...   103   1e-22
11_01_0564 - 4447078-4448519,4449465-4449711                          100   1e-21
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...    95   7e-20
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...    95   7e-20
12_02_0825 + 23476943-23476952,23477263-23477328,23477737-234778...    93   2e-19
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...    92   5e-19
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819     91   1e-18
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836           77   1e-14
01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425...    66   2e-11
05_01_0550 + 4820086-4821255,4822112-4822321,4822429-4822524,482...    66   4e-11
02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728...    52   6e-07
06_03_1137 + 27903012-27904196,27904330-27904542,27905775-279058...    49   5e-06
12_01_0346 + 2652181-2653566                                           46   2e-05
03_02_0180 - 6211823-6213559                                           39   0.005
05_07_0320 + 29235266-29235305,29235409-29236682                       35   0.078
06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    33   0.24 
09_04_0565 + 18580292-18580571,18582823-18583052                       31   0.97 
04_03_0694 + 18781776-18781994,18782475-18782648,18782743-187830...    30   1.7  
07_01_0786 + 6122144-6123187                                           30   2.2  
04_04_1042 - 30346132-30346285,30346629-30346759,30346867-303469...    29   2.9  
11_06_0370 + 22768977-22769523,22769619-22770642,22770784-227711...    29   3.9  
08_02_1261 + 25689487-25689666,25690642-25690887,25691032-256911...    29   3.9  
06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849     29   3.9  
10_01_0121 - 1493822-1494316                                           28   6.8  
08_02_0805 + 21400345-21400701,21400797-21400975,21401223-214012...    28   6.8  
07_03_0446 - 18285132-18285221,18285437-18285499,18285805-182858...    28   6.8  
06_03_1002 - 26826316-26826522                                         28   9.0  
03_04_0025 - 16557328-16557851,16558000-16558123,16558518-165586...    28   9.0  

>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  190 bits (464), Expect = 8e-49
 Identities = 115/211 (54%), Positives = 136/211 (64%), Gaps = 14/211 (6%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 
Sbjct: 5   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 64

Query: 258 PTT-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT 404
           PT            ++S P+V SD+  K+   K     G   + V++         + + 
Sbjct: 65  PTNTVFDAKRLIGRRFSDPSVQSDM--KLWPFKVVPGPGDKPMIVVQ--------YKGEE 114

Query: 405 KPFSPRKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLR 581
           K F+  +                L ++         AYFNDSQRQATKDAG I+GLNV+R
Sbjct: 115 KQFAAEEISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMR 174

Query: 582 IINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           IINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 175 IINEPTAAAIAYGLDKKATSSGEKNVLIFDL 205



 Score =  107 bits (257), Expect = 9e-24
 Identities = 51/76 (67%), Positives = 60/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D +VQ+DMK WPF+VV   G KP I V YKGE+K F  EE+S
Sbjct: 64  NPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEIS 123

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 124 SMVLIKMREIAEAYLG 139



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 207 GGTFDVSLLTIEEGIFEVKATAGDT 231


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  190 bits (462), Expect = 1e-48
 Identities = 118/216 (54%), Positives = 138/216 (63%), Gaps = 16/216 (7%)
 Frame = +3

Query: 69  KMAKA--PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +MAK   PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct: 193 EMAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 252

Query: 243 QVAMTPTT-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*H 389
           QVAM P             ++S P+V SD+  K+   K     G   + V++        
Sbjct: 253 QVAMNPINTVFDAKRLIGRRFSDPSVQSDM--KLWPFKVIPGPGDKPMIVVQ-------- 302

Query: 390 IRVKTKPFSPRKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISG 566
            + + K FS  +                L +N         AYFNDSQRQATKDAG I+G
Sbjct: 303 YKGEEKQFSAEEISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAG 362

Query: 567 LNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           LNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 363 LNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDL 398



 Score =  105 bits (253), Expect = 3e-23
 Identities = 50/76 (65%), Positives = 60/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D +VQ+DMK WPF+V+   G KP I V YKGE+K F  EE+S
Sbjct: 257 NPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEIS 316

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 317 SMVLIKMREIAEAYLG 332



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 400 GGTFDVSLLTIEEGIFEVKATAGDT 424


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  186 bits (454), Expect = 1e-47
 Identities = 114/211 (54%), Positives = 133/211 (63%), Gaps = 14/211 (6%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAM 
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN 66

Query: 258 PTT-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT 404
           P             ++S  +V SD+  KM   K     G   + V++         + + 
Sbjct: 67  PINTVFDAKRLIGRRFSDASVQSDI--KMWPYKVIPGPGDKPMIVVQ--------YKGEE 116

Query: 405 KPFSPRKSVPWCXXXXXXXXXXILANCAE-CSYHGSAYFNDSQRQATKDAGTISGLNVLR 581
           K FS  +                L +  +       AYFNDSQRQATKDAG I+GLNV+R
Sbjct: 117 KQFSAEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMR 176

Query: 582 IINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           IINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 177 IINEPTAAAIAYGLDKKATSVGEKNVLIFDL 207



 Score =  105 bits (252), Expect = 4e-23
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F DA+VQ+D+K WP++V+   G KP I V YKGE+K F  EE+S
Sbjct: 66  NPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEIS 125

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 126 SMVLIKMREIAEAYLG 141



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 209 GGTFDVSLLTIEEGIFEVKATAGDT 233


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  173 bits (422), Expect = 9e-44
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD+ERLIG+AAKNQ A+ P  +
Sbjct: 36  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNP--E 93

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK---TKPFSPRKSVPWC 440
            ++ +V   +  K    +      L    ++  + +    +++K    K FSP +     
Sbjct: 94  RTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMI 153

Query: 441 XXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +      AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAY
Sbjct: 154 LGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAY 213

Query: 618 GLDKKGTGERNVLIFDL 668
           GLDKKG GE+N+L+FDL
Sbjct: 214 GLDKKG-GEKNILVFDL 229



 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/77 (66%), Positives = 60/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  TIFD KRLIGRKFED  VQ DMK  P+++V+  GKP I+V  K GE+K F PEEVS
Sbjct: 91  NPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVS 150

Query: 431 SMVLTKMKETAEAYLGK 481
           +M+L KMKETAEAYLGK
Sbjct: 151 AMILGKMKETAEAYLGK 167



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI++G+FEV +T GDT
Sbjct: 231 GGTFDVSILTIDNGVFEVLATNGDT 255


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score =  173 bits (420), Expect = 2e-43
 Identities = 98/205 (47%), Positives = 127/205 (61%), Gaps = 5/205 (2%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +  K P +GIDLGTTYSCVGV+++G V+I+ANDQGNR TPS+VAFTD ERL+G+AAKNQ 
Sbjct: 33  RKTKGPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQA 92

Query: 249 AMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK---TKPFSP 419
           A+ P    ++ ++   +  +    +           V++   +    +RVK    K FSP
Sbjct: 93  ALNP--DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSP 150

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L     +      AYFND+QRQATKDAGTI+GLNV RIINEP
Sbjct: 151 EEISAMILAKMKETAESYLGQRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNVPRIINEP 210

Query: 597 TAAAIAYGLDKKGTGE-RNVLIFDL 668
           TAAAIAYGLD+KG GE  NVL++DL
Sbjct: 211 TAAAIAYGLDRKGAGEMTNVLVYDL 235



 Score =  108 bits (260), Expect = 4e-24
 Identities = 71/170 (41%), Positives = 98/170 (57%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P+ TIFD KRLIGR+F+D  VQ D+K+ P++VV  GGKP ++V  K GE K F PEE+S
Sbjct: 95  NPDRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEIS 154

Query: 431 SMVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           +M+L KMKETAE+YLG+     +    + F   Q    T        L + R  N     
Sbjct: 155 AMILAKMKETAESYLGQRVTDAVVTVPAYFNDAQ-RQATKDAGTIAGLNVPRIINEPTAA 213

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGDT 745
                L   +KG        +   GG TFDVS+L+++ G+FEV +T+GDT
Sbjct: 214 AIAYGLD--RKGAGEMTNVLVYDLGGGTFDVSVLSLDHGVFEVLATSGDT 261


>08_01_0654 - 5639419-5641449
          Length = 676

 Score =  163 bits (396), Expect = 1e-40
 Identities = 99/200 (49%), Positives = 124/200 (62%), Gaps = 7/200 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P  
Sbjct: 47  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP-- 104

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP-----FSPRKSV 431
           + ++ +    +  +    +      L   +V++ N   + H+RV+ K      FSP +  
Sbjct: 105 ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRN--GKPHVRVEVKDGDVRVFSPEEVS 162

Query: 432 PWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L            AYFND+QRQATKDAG I+GL V RIINEPTAAA
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAA 222

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           IAYG+DKKG  E+NVL+FDL
Sbjct: 223 IAYGIDKKG-AEKNVLVFDL 241



 Score =  114 bits (274), Expect = 8e-26
 Identities = 75/168 (44%), Positives = 98/168 (58%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 431 SMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRY--HLWLERSPNHQ*TDC 601
           +MVLT+MKETAEAYLG K+ R  ++         + + K       L ++R  N      
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINE--PTA 220

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                   +KG  +    +    GGTFDVSIL I++G+FEV +T GDT
Sbjct: 221 AAIAYGIDKKGAEKNVLVF-DLGGGTFDVSILAIDNGVFEVLATNGDT 267


>05_04_0392 - 20889699-20891726
          Length = 675

 Score =  161 bits (392), Expect = 4e-40
 Identities = 98/200 (49%), Positives = 124/200 (62%), Gaps = 7/200 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P  
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP-- 104

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP-----FSPRKSV 431
           + ++ +    +  +    +      L   +V++ N   + H+RV+ K      FSP +  
Sbjct: 105 ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRN--GKPHVRVEVKDGDVRVFSPEEVS 162

Query: 432 PWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L            AYFND+QRQATKDAG I+GL V RIINEPTAAA
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAA 222

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           IAYG+DKKG  E+NVL+FDL
Sbjct: 223 IAYGIDKKG-AEKNVLVFDL 241



 Score =  114 bits (274), Expect = 8e-26
 Identities = 75/168 (44%), Positives = 98/168 (58%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 431 SMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRY--HLWLERSPNHQ*TDC 601
           +MVLT+MKETAEAYLG K+ R  ++         + + K       L ++R  N      
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINE--PTA 220

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                   +KG  +    +    GGTFDVSIL I++G+FEV +T GDT
Sbjct: 221 AAIAYGIDKKGAEKNVLVF-DLGGGTFDVSILAIDNGVFEVLATNGDT 267


>05_04_0052 - 17515344-17517353
          Length = 669

 Score =  151 bits (367), Expect = 4e-37
 Identities = 93/201 (46%), Positives = 119/201 (59%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P  
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANPGR 101

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP-----FSPRKS 428
           T Y    +   +  +    +      L   +V++     + H+RV+ +       SP + 
Sbjct: 102 TVYDAKRL---IGRRFADAEVQRDMRLLPFAVVDKG--GKPHVRVEVRGGDVRLLSPEEV 156

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDA TI+GL V RI+NEPTAA
Sbjct: 157 SAMVLARMKETAEAYLGEEVTRAVVTVPAYFNDAQRQATKDAATIAGLAVERILNEPTAA 216

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           A+AYG+ K+G G +NVL+FDL
Sbjct: 217 ALAYGVGKEGAGGKNVLVFDL 237



 Score =  107 bits (258), Expect = 7e-24
 Identities = 69/168 (41%), Positives = 94/168 (55%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGED-KTFFPEEVS 430
           +P  T++DAKRLIGR+F DA VQ DM+  PF VV  GGKP ++V  +G D +   PEEVS
Sbjct: 98  NPGRTVYDAKRLIGRRFADAEVQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVS 157

Query: 431 SMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCR--YHLWLERSPNHQ*TDC 601
           +MVL +MKETAEAYLG ++ R  ++         + + K       L +ER  N      
Sbjct: 158 AMVLARMKETAEAYLGEEVTRAVVTVPAYFNDAQRQATKDAATIAGLAVERILNE--PTA 215

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                   ++G            GGTFDVS+L I+ G++EV +T GDT
Sbjct: 216 AALAYGVGKEGAGGKNVLVFDLGGGTFDVSVLAIDGGVYEVLATNGDT 263


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score =  129 bits (312), Expect = 2e-30
 Identities = 90/206 (43%), Positives = 113/206 (54%), Gaps = 11/206 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-----IGDAAKNQV 248
           PAVGIDLGTTYSCV V++ G+VE+I NDQGN TTPS VAFTDT RL     +  AA N +
Sbjct: 11  PAVGIDLGTTYSCVAVWRRGRVEVIPNDQGNLTTPSCVAFTDTWRLIGDAALNQAAMNPL 70

Query: 249 AMTPTTQYSMPNVSSDVSSK--MLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPR 422
                 +  +    SDVS +  + L     ++G     ++    R       + K FS  
Sbjct: 71  NTIFDAKRLIGRRFSDVSVQGDIKLWPFKVTSGKDDRPMIVVQYRG------EEKEFSAE 124

Query: 423 KSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
           +                L    E +      YFNDSQRQAT DAG ++GL+VLRIINEPT
Sbjct: 125 EISAMVLFKMKETAEAYLDKTVEKAVITVPVYFNDSQRQATMDAGAVAGLDVLRIINEPT 184

Query: 600 AAAIAYGLDK---KGTGERNVLIFDL 668
           AAA+AYGLDK       ++ VLIFDL
Sbjct: 185 AAAVAYGLDKVVGSSDKKKRVLIFDL 210



 Score =  104 bits (250), Expect = 6e-23
 Identities = 76/175 (43%), Positives = 94/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTIFDAKRLIGR+F D +VQ D+K WPF+V S    +P I V Y+GE+K F  EE+S
Sbjct: 68  NPLNTIFDAKRLIGRRFSDVSVQGDIKLWPFKVTSGKDDRPMIVVQYRGEEKEFSAEEIS 127

Query: 431 SMVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSK---TSHKRCRYHLWLERSPNHQ*TDC 601
           +MVL KMKETAEAYL K     +    V    S+   T        L + R  N      
Sbjct: 128 AMVLFKMKETAEAYLDKTVEKAVITVPVYFNDSQRQATMDAGAVAGLDVLRIINEPTAAA 187

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIED------GIFEVKSTAGDT 745
               L        + K   +   GG T DVS+L I+       GIFEVK+TAGDT
Sbjct: 188 VAYGLDKVVGSSDKKKRVLIFDLGGGTLDVSVLNIDPGVDIDIGIFEVKATAGDT 242


>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  128 bits (310), Expect = 3e-30
 Identities = 80/169 (47%), Positives = 96/169 (56%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D +VQ+D K WPF+V+   G KP I V YKGE+K F  EE+S
Sbjct: 65  NPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSAEEIS 124

Query: 431 SMVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           SMVL KMKETAEAYLG   +  +    + F   Q    T        L + R  N     
Sbjct: 125 SMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQ-RQATKDAGVISGLNVMRIINEPTAA 183

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                L                  GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 184 AIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDT 232



 Score =  117 bits (282), Expect = 9e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P
Sbjct: 8   PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 66



 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKSSSVGEKNVLIFDL 206


>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  121 bits (292), Expect = 5e-28
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 66

Query: 258 PT 263
           PT
Sbjct: 67  PT 68



 Score =  106 bits (255), Expect = 2e-23
 Identities = 51/75 (68%), Positives = 59/75 (78%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D +VQADMK WPF+VV     KP I V YKGE+K F  EE+S
Sbjct: 66  NPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSAEEIS 125

Query: 431 SMVLTKMKETAEAYL 475
           SMVLTKMKE AEA+L
Sbjct: 126 SMVLTKMKEIAEAFL 140



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 49/55 (89%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDL 668
           AYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK   TGE+NVLIFDL
Sbjct: 153 AYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAASTGEKNVLIFDL 207



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIE+GIFEVK+TAGDT
Sbjct: 209 GGTFDVSILTIEEGIFEVKATAGDT 233


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  116 bits (279), Expect = 2e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMN 65

Query: 258 P 260
           P
Sbjct: 66  P 66



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/76 (65%), Positives = 62/76 (81%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F DA+VQ+D+K WPF+V++  G KP I V YKGE+K F  EE+S
Sbjct: 65  NPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 125 SMVLIKMREIAEAYLG 140



 Score = 97.9 bits (233), Expect = 7e-21
 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDL 206



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score =  116 bits (278), Expect = 3e-26
 Identities = 73/201 (36%), Positives = 109/201 (54%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVAMTPT 263
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P 
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSPG 96

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK-----TKPFSPRKS 428
              ++ +    +  K  L        ++RL     ++  + H+ V+      +  SP + 
Sbjct: 97  R--AVHDFMRLLGKK--LGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEI 152

Query: 429 VPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +      YFND+QR+A  DAG I+GL+V+RI++EP AA
Sbjct: 153 AAAVLAKMKKTAEAHLGRTVSSAVVAVPVYFNDAQRRAISDAGDIAGLDVMRIVSEPIAA 212

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           A+AYGLD   +  + V++FDL
Sbjct: 213 AVAYGLDNVRSNGKRVVVFDL 233



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV-AYKGEDKTF 412
           +E     P   + D  RL+G+K  D  VQ +M   P+ VV   GKP + V A  G+ +  
Sbjct: 88  KEQAVGSPGRAVHDFMRLLGKKLGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVL 147

Query: 413 FPEEVSSMVLTKMKETAEAYLGK 481
            PEE+++ VL KMK+TAEA+LG+
Sbjct: 148 SPEEIAAAVLAKMKKTAEAHLGR 170


>12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231
          Length = 270

 Score =  114 bits (274), Expect = 8e-26
 Identities = 78/202 (38%), Positives = 103/202 (50%), Gaps = 2/202 (0%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           ++A    VGIDLGTT S V   + GK  +I N +G RTTPS VA+T   ERL+G  AK Q
Sbjct: 47  RVACEKVVGIDLGTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQ 106

Query: 246 VAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
             + P   +   +V   +  KM       +  +S   V + N   +       K F+  +
Sbjct: 107 AVVNPENTFF--SVKRFIGRKMAEVDDE-AKQVSYHVVRDDNGNVKLDCPAIGKQFAAEE 163

Query: 426 -SVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
            S              +     +      AYFNDSQR ATKDAG I+GL VLRIINEPTA
Sbjct: 164 ISAQVLRKLVDDASKFLNDKITKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTA 223

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           A++AYG +KK      +L+FDL
Sbjct: 224 ASLAYGFEKK--NNETILVFDL 243



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT F  KR IGRK   A V  + K   + VV D     +K+      K F  EE+S+
Sbjct: 110 NPENTFFSVKRFIGRKM--AEVDDEAKQVSYHVVRD-DNGNVKLDCPAIGKQFAAEEISA 166

Query: 434 MVLTKMKETAEAYL 475
            VL K+ + A  +L
Sbjct: 167 QVLRKLVDDASKFL 180


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score =  103 bits (248), Expect = 1e-22
 Identities = 71/195 (36%), Positives = 98/195 (50%), Gaps = 2/195 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTT 266
           +GIDLGTT SCV V +    ++I N +G RTTPS VAF    ERL+G  AK Q    P  
Sbjct: 55  IGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGERLVGTPAKRQAVTNP-- 112

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
           Q +       +  +    +      +    +++A            K +SP +   +   
Sbjct: 113 QNTFFGTKRLIGRRFEDPQTQKEMKMVPYKIVKAPNGDAWVETTDGKQYSPSQIGAFVLT 172

Query: 447 XXXXXXXXILANC-AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    ++      AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG 
Sbjct: 173 KMKETAESYLGKTVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGT 232

Query: 624 DKKGTGERNVLIFDL 668
           + K   E  + +FDL
Sbjct: 233 NNK---EGLIAVFDL 244



 Score = 71.3 bits (167), Expect = 7e-13
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT F  KRLIGR+FED   Q +MK  P+++V +  G   ++     + K + P ++ 
Sbjct: 111 NPQNTFFGTKRLIGRRFEDPQTQKEMKMVPYKIVKAPNGDAWVETT---DGKQYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLGK 481
           + VLTKMKETAE+YLGK
Sbjct: 168 AFVLTKMKETAESYLGK 184



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I +G+FEVK+T GDT
Sbjct: 246 GGTFDVSILEISNGVFEVKATNGDT 270


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score =  100 bits (240), Expect = 1e-21
 Identities = 46/77 (59%), Positives = 60/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTIF+ KRLIGR+F D +VQ D+K WPF+VV+    +P I V ++GE++ F PEE+S
Sbjct: 76  NPTNTIFEVKRLIGRRFSDDSVQKDIKLWPFKVVAGQEDRPMIVVRHEGEERQFMPEEIS 135

Query: 431 SMVLTKMKETAEAYLGK 481
           SMVL KM+ETAE YLGK
Sbjct: 136 SMVLAKMRETAEVYLGK 152



 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMT 257
           PAVGIDLGTTYSCV V++H + E+IANDQGNR TPS VAFT  D +  +GDAA NQ A+ 
Sbjct: 17  PAVGIDLGTTYSCVAVWRHDRGEVIANDQGNRLTPSCVAFTADDDDSFVGDAAFNQSALN 76

Query: 258 PT 263
           PT
Sbjct: 77  PT 78



 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 37/54 (68%), Positives = 44/54 (81%), Gaps = 2/54 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE--RNVLIFDL 668
           YFN++QRQAT DAG I+GLNV+RIINEPTAAA+AYGL+K       R VL+FDL
Sbjct: 164 YFNNAQRQATMDAGAIAGLNVMRIINEPTAAALAYGLEKMPVSNKGRMVLVFDL 217



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 6/31 (19%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGI------FEVKSTAGDT 745
           GGTFD+S+L I+ G+      FEVK+TAGDT
Sbjct: 219 GGTFDISLLNIDPGVNIDMGLFEVKATAGDT 249


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 66/178 (37%), Positives = 90/178 (50%), Gaps = 2/178 (1%)
 Frame = +3

Query: 141 GKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLL 317
           GK  I+ N +G RTTPS VA+T + +RL+G  AK Q  + P   +   +V   +  KM  
Sbjct: 4   GKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFF--SVKRFIGRKMNE 61

Query: 318 CKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPWCXXXXXXXXXXILANCAEC 494
                S  +S   + + N   +       K F+  + S              +     + 
Sbjct: 62  VDEE-SKQVSYRVIRDDNGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKVTKA 120

Query: 495 SYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
                AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDL
Sbjct: 121 VITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDL 176



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 52/167 (31%), Positives = 76/167 (45%), Gaps = 3/167 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT F  KR IGRK  +  V  + K   + V+ D     +K+      K F  EE+S+
Sbjct: 43  NPENTFFSVKRFIGRKMNE--VDEESKQVSYRVIRDDNG-NVKLDCPAIGKQFAAEEISA 99

Query: 434 MVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
            VL K+ + A  +L  K+ +  ++         +T+ K       LE  R  N       
Sbjct: 100 QVLRKLVDDASKFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEP---TA 156

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                  +K    T   +    GGTFDVS+L + DG+FEV ST+GDT
Sbjct: 157 ASLAYGFEKKNNETILVFD-LGGGTFDVSVLEVGDGVFEVLSTSGDT 202


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score = 94.7 bits (225), Expect = 7e-20
 Identities = 66/194 (34%), Positives = 96/194 (49%), Gaps = 1/194 (0%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTT SCV V +    ++I N +G RTTPS VAF     L+      + A+T   Q
Sbjct: 35  IGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVT-NPQ 93

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXXX 449
            +       +  +    +      +    +++A            K +SP +   +    
Sbjct: 94  NTFFGTKRLIGRRFDDPQTQKEMKMVPYKIVKALNGDAWLETTDGKQYSPSQIGAFVLTK 153

Query: 450 XXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD 626
                   L  + ++      AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG +
Sbjct: 154 MKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTN 213

Query: 627 KKGTGERNVLIFDL 668
            K   E  + +FDL
Sbjct: 214 NK---EGLIAVFDL 224



 Score = 68.9 bits (161), Expect = 4e-12
 Identities = 34/77 (44%), Positives = 49/77 (63%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT F  KRLIGR+F+D   Q +MK  P+++V    G   ++     + K + P ++ 
Sbjct: 91  NPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKIVKALNGDAWLETT---DGKQYSPSQIG 147

Query: 431 SMVLTKMKETAEAYLGK 481
           + VLTKMKETAE+YLGK
Sbjct: 148 AFVLTKMKETAESYLGK 164



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I +G+FEVK+T GDT
Sbjct: 226 GGTFDVSILEISNGVFEVKATNGDT 250


>12_02_0825 +
           23476943-23476952,23477263-23477328,23477737-23477885,
           23478148-23478212,23479247-23479710,23479724-23480208
          Length = 412

 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 63/151 (41%), Positives = 80/151 (52%), Gaps = 5/151 (3%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 451
           DAKRLIG++F DA+VQ+D+  WPF+V++  G K  I V YKGE+K F  EE+SSMVL KM
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKM 161

Query: 452 KETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCCCDCLR 619
           +E AEAYLG   +  +    + F   Q    T   R    L + R  N          L 
Sbjct: 162 REIAEAYLGTTIKKAVVTVPAYFNYSQ-RQATKDARVIAGLNVMRIINEPTAAAIAYGLD 220

Query: 620 S*QKGYWRTKCTYL*PRGGTFDVSILTIEDG 712
                            GGTFDVS+LTIE+G
Sbjct: 221 KKASSVGEKNVLIFDLGGGTFDVSLLTIEEG 251



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDL
Sbjct: 182 AYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDL 236



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           N   +AKRLIGR+F DA+VQ+D+K WPF+V++  G K  I V YKGE+K    E++    
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKSTIVVQYKGEEKQVAAEQIDDET 81

Query: 440 LTKMKETAEAYLGKLC 487
           ++     A+ Y G LC
Sbjct: 82  ISPSVCYADPYDGGLC 97


>11_01_0563 +
           4423609-4423846,4424671-4426132,4428949-4429364,
           4430555-4432052,4432199-4432217,4432469-4432675,
           4432814-4433065
          Length = 1363

 Score = 91.9 bits (218), Expect = 5e-19
 Identities = 40/77 (51%), Positives = 60/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTIF+ KRLIGR+F D +VQ D+K WPF+V++    +P I V ++G++K F PEE+S
Sbjct: 73  NPTNTIFEVKRLIGRRFSDKSVQEDIKLWPFKVIAGRDDRPTIVVRHEGKEKQFVPEEIS 132

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVL+K+++ A AYLG+
Sbjct: 133 AMVLSKLRDAAVAYLGE 149



 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 39/60 (65%), Positives = 47/60 (78%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSC  V +H + E+I NDQGNR TPS VAFT  +R +GDAA+NQ A+ PT
Sbjct: 642 PAIGIDLGTTYSCAAVRRHNRSEVITNDQGNRITPSCVAFTADDRFVGDAAENQAALNPT 701



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 40/77 (51%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTIF+AKRLIGR+F   +VQ D+K WPF+VV+    +P I V ++G++  F PEE+S
Sbjct: 699 NPTNTIFEAKRLIGRRFSSKSVQEDIKLWPFKVVAGPDDRPTIVVQHEGKEMQFVPEEIS 758

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVL+K+++ A AYLG+
Sbjct: 759 AMVLSKLRDAAVAYLGE 775



 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 39/60 (65%), Positives = 46/60 (76%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCV V +  + E I NDQGNR TPS VAFT  +R +GDAA+NQ A+ PT
Sbjct: 16  PAIGIDLGTTYSCVAVRRRYRSEAITNDQGNRITPSCVAFTAADRFVGDAAENQAALNPT 75



 Score = 74.9 bits (176), Expect = 6e-14
 Identities = 38/56 (67%), Positives = 45/56 (80%), Gaps = 4/56 (7%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNVLIFDL 668
           YFN++QR+AT DA TI+GLNV+RIINEP+AAA+AYGLDK     G   R VLIFDL
Sbjct: 161 YFNNAQREATLDAATIAGLNVMRIINEPSAAALAYGLDKMPPASGGAGRMVLIFDL 216



 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 8/60 (13%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--------GTGERNVLIFDL 668
           YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK         G   R VLIFDL
Sbjct: 787 YFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPPASGGGAAVRTVLIFDL 846



 Score = 36.7 bits (81), Expect = 0.019
 Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 7/32 (21%)
 Frame = +2

Query: 671  GGTFDVSILTIEDGI-------FEVKSTAGDT 745
            GGTFDVS+L I+ G+       FEVK+TAGDT
Sbjct: 1238 GGTFDVSLLNIDPGVNTDMGRLFEVKATAGDT 1269


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 38/60 (63%), Positives = 47/60 (78%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTDTERL+GDAAK+Q +  PT
Sbjct: 10  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDTERLVGDAAKSQASRNPT 69



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 41/76 (53%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+F  KRL+GR+F DA+VQ  +K WPF+VV   G KP +  +YKG+ K    EEV+
Sbjct: 67  NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVA 126

Query: 431 SMVLTKMKETAEAYLG 478
           SM+L+KMK  AEAY+G
Sbjct: 127 SMLLSKMKAEAEAYIG 142



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 26/53 (49%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR+ATK A  ++GL+VL +I+ P AAA+A+G+ +   G++NVL+FDL
Sbjct: 154 ASFDVLQRRATKHACAVAGLDVLGVIHGPAAAAVAFGIHEI-AGDKNVLVFDL 205


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/70 (50%), Positives = 53/70 (75%), Gaps = 1/70 (1%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 451
           +AKRLIGR+F D +VQ D+K WPF+V++    +P I V ++G++  F PEEVS+MVL+K+
Sbjct: 16  EAKRLIGRRFSDKSVQEDIKLWPFKVIAGPDDRPTIVVQHEGKEMQFVPEEVSAMVLSKL 75

Query: 452 KETAEAYLGK 481
           ++ A AYL +
Sbjct: 76  RDAAVAYLSE 85



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 37/59 (62%), Positives = 43/59 (72%), Gaps = 7/59 (11%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-------KGTGERNVLIFDL 668
           YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK            R VLIFDL
Sbjct: 97  YFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPASGADAAGRTVLIFDL 155


>01_01_0573 +
           4253484-4254653,4255526-4255735,4255842-4255937,
           4256034-4256255,4256829-4257023,4257097-4257243,
           4257323-4257472,4257762-4257892,4257978-4258194
          Length = 845

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 55/201 (27%), Positives = 84/201 (41%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT- 266
           VG DLG     V V +   ++++ N++  R TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNPKNS 63

Query: 267 ----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
                     +YS P +  D+++         S G     ++ A          + + F+
Sbjct: 64  VSQIKRLLGRKYSDPELQRDIAAFPFRV----SEGPDGFPLVHARYLG------EERVFT 113

Query: 417 PRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L     +C      YF D QR+A  DA TI+GL  LR+ +E
Sbjct: 114 PTQLMAMVLSNLKGIAESNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLCPLRLFHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E + L
Sbjct: 174 TTATALAYGIYKTDLPENDQL 194



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG--GKPKIKVAYKGEDKTFFPEEV 427
           +P N++   KRL+GRK+ D  +Q D+  +PF  VS+G  G P +   Y GE++ F P ++
Sbjct: 59  NPKNSVSQIKRLLGRKYSDPELQRDIAAFPFR-VSEGPDGFPLVHARYLGEERVFTPTQL 117

Query: 428 SSMVLTKMKETAEAYL 475
            +MVL+ +K  AE+ L
Sbjct: 118 MAMVLSNLKGIAESNL 133


>05_01_0550 +
           4820086-4821255,4822112-4822321,4822429-4822524,
           4822610-4822828,4823201-4823395,4823466-4823612,
           4823712-4823861,4825015-4825145,4825234-4825477
          Length = 853

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 55/201 (27%), Positives = 83/201 (41%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     V V +   ++++ N++  R TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNPRNS 63

Query: 270 YSM-----------PNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
            S            P +  D++S         S G     ++ A          + + F+
Sbjct: 64  VSQIKRLLGRAFADPELQRDLASFPFRV----SEGPDGFPLVHARYLG------EDRAFT 113

Query: 417 PRKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L A   +C     AYF D QR+A  DA  I+GL  LR+ +E
Sbjct: 114 PTQLLAMVLSNLKGIAEGNLNAAVFDCCIGIPAYFTDLQRRAVADAAAIAGLRPLRLFHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E+  L
Sbjct: 174 TTATALAYGIYKTDLPEKEWL 194



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG--GKPKIKVAYKGEDKTFFPEEV 427
           +P N++   KRL+GR F D  +Q D+  +PF  VS+G  G P +   Y GED+ F P ++
Sbjct: 59  NPRNSVSQIKRLLGRAFADPELQRDLASFPFR-VSEGPDGFPLVHARYLGEDRAFTPTQL 117

Query: 428 SSMVLTKMKETAEAYL 475
            +MVL+ +K  AE  L
Sbjct: 118 LAMVLSNLKGIAEGNL 133


>02_05_0491 +
           29470575-29471351,29471574-29471806,29472697-29472856,
           29473149-29473394,29473492-29473628,29473874-29474207,
           29474283-29474444,29474717-29474791,29474866-29474966,
           29475042-29475111,29475210-29475266,29475357-29475418,
           29475505-29475577,29475663-29475884
          Length = 902

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 1/55 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLAA 674
           YF  ++R+A   A  ++G+NVL +INE   AA+ YG+DK  + E R+V+ +D+ A
Sbjct: 177 YFGQAERRALTQAAQLAGVNVLALINEHAGAALQYGIDKDFSNESRHVIFYDMGA 231


>06_03_1137 +
           27903012-27904196,27904330-27904542,27905775-27905867,
           27905940-27906008,27906412-27906612,27906688-27906834,
           27907524-27907652,27909001-27909131,27909240-27909333
          Length = 753

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 52/194 (26%), Positives = 82/194 (42%), Gaps = 10/194 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G         +   ++++ N + NR +P+ VAF+   RL+G  A    A +    
Sbjct: 4   VGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNARLLGPHAAG-AASSHAPF 62

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSV-MEAN--------LRSR*HIRVKTKPFSPR 422
            S+  +        LL  P     LSRL   +EA+        L    HI  +    SP 
Sbjct: 63  SSIKRLLLLAGRPTLL--PRRGGDLSRLPFPVEASSADGGGGVLVHVDHIGRRIA-LSPT 119

Query: 423 KSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
           + +              L A  ++C      YF  +QRQA  DA  ++GL  LR++++  
Sbjct: 120 QLLAMLLGYLRQLAEADLEAPVSDCVISVPCYFTQAQRQAYLDAAAVAGLRPLRLMHDLA 179

Query: 600 AAAIAYGLDKKGTG 641
           A A+ YGL +   G
Sbjct: 180 ATALGYGLYRSDLG 193


>12_01_0346 + 2652181-2653566
          Length = 461

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 19/37 (51%), Positives = 29/37 (78%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL
Sbjct: 187 YFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGL 223



 Score = 36.7 bits (81), Expect = 0.019
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +2

Query: 281 KRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV--AYKGEDKTFFPEEVSSMVLTKMK 454
           KRL+G +F    V+   +H P+++V       I+V     G  ++ +  +V+SMV+ ++K
Sbjct: 104 KRLLGTRFGSPEVRRAAEHLPYKIVDWCTMAHIEVNAGAGGAARSVYASDVASMVIAELK 163

Query: 455 ETAEAYL 475
             AEA L
Sbjct: 164 ARAEARL 170



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 251
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           + IF+ KRLIGR   D  VQA  K  PF  + +  G +P I        ++  PEEV ++
Sbjct: 94  SAIFNMKRLIGRMDTDEVVQAS-KSLPFLVQTLGIGVRPFIAALVNNMWRSTTPEEVLAI 152

Query: 437 VLTKMKETAEAYL 475
            L ++K   E +L
Sbjct: 153 FLLELKALVEMHL 165



 Score = 35.5 bits (78), Expect = 0.045
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   V V+   +VE++ N +  +   SYV F D
Sbjct: 28  AIGIDIGTSNCSVAVWTGHQVELLKNTRNQKGMRSYVMFKD 68



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 8/61 (13%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLA 671
           F+  Q+   + A  ++GL+VLR++ EPTA A+ Y         D  G+G E+  LIF++ 
Sbjct: 180 FSRFQQTRIERACAMAGLHVLRLMPEPTAIALLYAQQQQQLLHDNMGSGIEKIALIFNMG 239

Query: 672 A 674
           A
Sbjct: 240 A 240


>05_07_0320 + 29235266-29235305,29235409-29236682
          Length = 437

 Score = 34.7 bits (76), Expect = 0.078
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY----KGEDKTFFPE 421
           D +  I   KRLIG +  D   +   +  P+++    G+  I+V      K   + F PE
Sbjct: 97  DHSAAISGFKRLIGLQPGDPHAKRVAQIAPYKLGEKIGRCSIQVQLDDGAKCRVEDFLPE 156

Query: 422 EVSSMVLTKMKETAEAYLG 478
           +V+ +++  +K TAEA+LG
Sbjct: 157 DVAGILIAHLKSTAEAHLG 175



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           +FN +QRQ      T   G   + +++E  AAA A+GL +     + +L+F L
Sbjct: 188 HFNGNQRQEVSSGSTEYGGFRYVSVVDEQVAAAAAHGLHEDRGDGKVILVFHL 240


>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 33.1 bits (72), Expect = 0.24
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           +Y  D ++  +  A   SG   +++++E  AAA AYG   K    + +L+F L
Sbjct: 233 SYSADGRQVLSSAAKEYSGFRAVKVVDEHIAAAAAYGHHTKQGDRKAILVFHL 285



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNR-TTPSYVAFT-DTERLI-GDAAKNQVAMT 257
           A  I LG T SC+  +      + A     +   PS+VA   D   +I G+AA N+ A++
Sbjct: 70  AAAIHLGNTNSCIAGYDDDDAPLGAKRSYYQFCIPSWVALAHDNGTVISGEAAMNRAALS 129

Query: 258 PTTQYS 275
           P+T  S
Sbjct: 130 PSTAVS 135


>09_04_0565 + 18580292-18580571,18582823-18583052
          Length = 169

 Score = 31.1 bits (67), Expect = 0.97
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -2

Query: 192 KTEWSCCPGRWR*SPPSRAGRH 127
           K  WSCC  R   +PP R GRH
Sbjct: 138 KGRWSCCQERDEGAPPCRRGRH 159


>04_03_0694 +
           18781776-18781994,18782475-18782648,18782743-18783057,
           18783791-18785569,18786334-18786651,18787052-18787105
          Length = 952

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = -3

Query: 287 DVWHRILCCWGHRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARV 114
           ++  R+ CC G R  V  G  D T+G+ +R  R S          L L  L+  N  +
Sbjct: 22  EIASRVSCCSGGRGRVAVGCDDGTVGLLDRGFRLSYGFQAYASSVLFLQQLKQRNVLI 79


>07_01_0786 + 6122144-6123187
          Length = 347

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = -1

Query: 442 KHHGTDFLGEKGFVFTLICY-LDLRFASITDNLERPVLHVGLHSSIFELTSDETFGIEYC 266
           KH     +G  G   T +   L L+F     N ++  LH GL  +  + T+DE  G+ + 
Sbjct: 51  KHKAVVVMGATGTGKTRLAVDLALQFGGEVINADKLQLHRGLDVATNKATADERAGVPHH 110

Query: 265 VVGV 254
           ++GV
Sbjct: 111 LIGV 114


>04_04_1042 -
           30346132-30346285,30346629-30346759,30346867-30346938,
           30347284-30347370,30347479-30347505,30347777-30347869,
           30348470-30348558,30348649-30348727,30349102-30349231,
           30349344-30349464,30349619-30349726,30349837-30350152
          Length = 468

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -2

Query: 132 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLS-KRARLLV 4
           +H R   W+ D F L +LL F +    CYL L+    +R R L+
Sbjct: 71  KHARFLNWHLDLFCLILLLVFVLPYYHCYLLLRNSGVRRERALL 114


>11_06_0370 +
           22768977-22769523,22769619-22770642,22770784-22771170,
           22771216-22771507
          Length = 749

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 422 EVSSMVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ 589
           E+   ++ K+K+    + GK    Q S F  +   ++  H R  Y  WLE +PNHQ
Sbjct: 486 EMWDSMIDKVKKIIYRHEGKELDEQCSFFFHV---NEILHFRYYYETWLEEAPNHQ 538


>08_02_1261 +
           25689487-25689666,25690642-25690887,25691032-25691128,
           25691233-25691630,25692013-25692267
          Length = 391

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRS 204
           +W+P+  +L     G W  SP  ++  P  +++ S
Sbjct: 357 VWIPKHFSLSQDKNGSWECSPLEKSVPPAPIIVPS 391


>06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849
          Length = 489

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +1

Query: 124 LVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTR 246
           L+  +  RW   P  R     +L+LR   P  SSE+P  T+
Sbjct: 171 LLGGAERRWSPPPPPRPKPKHKLVLREIEPGESSEVPSETK 211


>10_01_0121 - 1493822-1494316
          Length = 164

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +2

Query: 68  QNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPG 172
           + G+  R     G   L RWC   R+GG  R R G
Sbjct: 36  RRGRQIRPLEGHGRQRLWRWCSGGRQGGMQRGRSG 70


>08_02_0805 +
           21400345-21400701,21400797-21400975,21401223-21401271,
           21401310-21401390,21401988-21402605
          Length = 427

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = -1

Query: 721 LEDTILDGKDGHVEGTAARS 662
           L +T  DG+ GH+EGTA R+
Sbjct: 49  LNETWTDGRRGHIEGTAYRA 68


>07_03_0446 - 18285132-18285221,18285437-18285499,18285805-18285867,
            18286079-18286129,18286413-18286506,18286696-18286856,
            18287089-18287145,18287380-18287493,18287934-18287999,
            18288063-18288266,18289207-18289284,18289669-18289788,
            18290425-18290491,18290635-18290735,18290820-18290936,
            18292024-18292107,18292181-18292309,18292385-18292510,
            18292622-18292696,18292814-18292947,18293032-18293137,
            18293220-18293276,18294387-18294573,18295244-18295407,
            18296129-18296353,18296538-18296744,18297043-18297375,
            18297604-18297993
          Length = 1220

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 9/93 (9%)
 Frame = -1

Query: 484  QFAKISFGSFL--HFRKHHGTDFLGEKGFVFTL---ICYLDLR----FASITDNLERPVL 332
            QF       FL  HF     T    EKG   TL   I Y+ LR    F S  +  +  + 
Sbjct: 903  QFLMDDVSDFLSTHFSSSVDTSKTEEKGCASTLKAFIDYISLRETENFRSRKEENKNSIT 962

Query: 331  HVGLHSSIFELTSDETFGIEYCVVGVIATWFLA 233
               +H         ++ G+E+ VV ++  +FLA
Sbjct: 963  LTTIHQMYIPFYDSQSKGLEWDVVFIVQEYFLA 995


>06_03_1002 - 26826316-26826522
          Length = 68

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 11/39 (28%), Positives = 19/39 (48%)
 Frame = -3

Query: 572 VQARDGTCIFCGLSLRVIEVRGTVITAFCTVCQDKLRQF 456
           VQ   G+C +CG  +   +V    +  F  +C +  R+F
Sbjct: 12  VQKAPGSCPYCGGGVAATDVEAKWVLCFLPLCLNNKRRF 50


>03_04_0025 -
           16557328-16557851,16558000-16558123,16558518-16558654,
           16561050-16561185,16561296-16561721
          Length = 448

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +2

Query: 83  TRSRNRSGYHVLLRWCLP-AREGGDHRQRPGQQDHSVLCCVHRHRAS 220
           TR + RSG+  L R CL      G  + RPG +  +     H   AS
Sbjct: 2   TRKKERSGWGSLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGAS 48


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,216,010
Number of Sequences: 37544
Number of extensions: 537560
Number of successful extensions: 1753
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 1566
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1705
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1968901276
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -