BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0092 (593 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0325 - 2552808-2553895,2553999-2554300,2555014-2555447 30 1.6 08_01_0764 - 7332969-7333870,7334044-7334369,7334712-7335384,733... 29 2.8 03_03_0206 + 15447054-15447181,15448243-15448298,15448373-154485... 29 3.7 12_02_0616 - 21246374-21246462,21246605-21247702,21247800-212481... 28 4.9 10_08_0095 + 14760292-14760624,14760689-14761000,14761768-147624... 28 4.9 04_01_0222 - 2805329-2805780,2805866-2806611,2806730-2806778,280... 28 4.9 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 28 6.5 07_03_1774 + 29425486-29425831,29426018-29426235,29426337-294271... 27 8.5 04_04_0611 - 26594737-26594991,26595307-26595396,26595490-265955... 27 8.5 02_05_0094 - 25758213-25758479,25758886-25758975,25759090-257591... 27 8.5 >05_01_0325 - 2552808-2553895,2553999-2554300,2555014-2555447 Length = 607 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVCXVPRD 214 FCK SCC C SL LVC D Sbjct: 68 FCKRCSCCICHQFDDNKDPSLWLVCASEND 97 >08_01_0764 - 7332969-7333870,7334044-7334369,7334712-7335384, 7336195-7336219 Length = 641 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 +CK SCC C + SL LVC Sbjct: 155 YCKRCSCCICHKYDENKDPSLWLVC 179 >03_03_0206 + 15447054-15447181,15448243-15448298,15448373-15448515, 15448630-15448827,15448901-15449100,15449585-15449684, 15449769-15450350,15450434-15450556,15451028-15451108, 15451188-15451495,15451577-15451816,15452261-15452345, 15452429-15452606,15453053-15453227,15453826-15453982 Length = 917 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 431 PTNIGRLLGSRRINICAERFPIY 499 PT++GRL R+N+C+E IY Sbjct: 32 PTDVGRLACVSRLNLCSENDEIY 54 >12_02_0616 - 21246374-21246462,21246605-21247702,21247800-21248110, 21248550-21249251,21252802-21252912,21253396-21253481, 21253753-21253862,21254085-21254236,21254656-21254765 Length = 922 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 FCK SCC C SL LVC Sbjct: 347 FCKRCSCCICHLFDDNKDPSLWLVC 371 >10_08_0095 + 14760292-14760624,14760689-14761000,14761768-14762489, 14762905-14763187,14763419-14763650,14763736-14764187 Length = 777 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 297 LVEQLEIILSCGPSYAGRGFVLASEDAPSRGTXQTSGRLDLA 172 L+ Q + I + G S AG+G LA E SRG+ R D A Sbjct: 272 LLAQQQNIATPGVSSAGKGKRLADEAGTSRGSASKKSRSDSA 313 >04_01_0222 - 2805329-2805780,2805866-2806611,2806730-2806778, 2807031-2807748,2808513-2808824 Length = 758 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 297 LVEQLEIILSCGPSYAGRGFVLASEDAPSRGTXQTSGRLDLA 172 L+ Q + I + G S AG+G LA E SRG+ R D A Sbjct: 161 LLAQQQNIATPGVSSAGKGKRLADEAGTSRGSASKKSRSDSA 202 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 184 SAAGLPGSSRWSIFGSQDKAPACIAGPTTQNDFQLLD 294 + AGL SS ++FG K AC + P + D +LD Sbjct: 1327 AGAGLYDSSLKNLFGITTKLTACFSVPMDEEDEVILD 1363 >07_03_1774 + 29425486-29425831,29426018-29426235,29426337-29427131, 29427206-29428074,29428317-29428749,29429263-29429859 Length = 1085 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 84 LFCLCFYHFFVCFNLFKFCTKN 19 LF LCF+ F + FN TKN Sbjct: 97 LFVLCFFLFQIAFNCLLITTKN 118 >04_04_0611 - 26594737-26594991,26595307-26595396,26595490-26595515, 26595603-26595702,26595820-26595954 Length = 201 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 226 GSQDKAPACIAGPTTQNDFQLLDEEYIRETLSCHRGRCIWT 348 G+QDK AC L E Y + C G CI T Sbjct: 100 GTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILT 140 >02_05_0094 - 25758213-25758479,25758886-25758975,25759090-25759118, 25759208-25759307,25759411-25759545 Length = 206 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 226 GSQDKAPACIAGPTTQNDFQLLDEEYIRETLSCHRGRCIWT 348 G+QDK AC L E Y + C G CI T Sbjct: 101 GTQDKCAACQKTVYPLEKLTLEGESYHKSCFKCSHGGCILT 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,482,477 Number of Sequences: 37544 Number of extensions: 331632 Number of successful extensions: 703 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -