SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0618 - 4941906-4942118,4942231-4942343,4942534-4942651,494...    78   8e-15
02_01_0001 - 3864-4049,4861-4917,5514-5648,5710-5808,5884-5952,6...    78   8e-15
04_03_1011 - 21708503-21708544,21708689-21708898,21709000-217091...    71   2e-12
02_04_0214 - 20976977-20977171,20977499-20977611,20978041-209781...    68   1e-11
04_03_0988 - 21469811-21469831,21470823-21471047,21471327-214716...    67   2e-11
06_01_0452 + 3198475-3198962,3199062-3199191,3199332-3199497,319...    65   8e-11
01_03_0161 + 13337265-13337297,13337880-13338017,13338211-133383...    64   1e-10
05_01_0410 - 3234455-3234466,3234851-3234950,3235037-3235161,323...    63   3e-10
02_04_0182 + 20719782-20720033,20720502-20720605,20720693-207210...    61   1e-09
09_04_0345 + 16876489-16876614,16876718-16876876,16877989-168781...    58   9e-09
07_03_0651 + 20287661-20287701,20288034-20288124,20288737-202888...    42   5e-04
07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288           40   0.004
07_01_0656 - 4912985-4913143,4913700-4913822,4914081-4914215           38   0.014
02_05_0085 - 25697860-25698142,25698631-25698946,25700481-257005...    37   0.019
10_08_0532 + 18580579-18580746,18581923-18581997,18582659-185838...    36   0.033
04_04_0598 - 26514226-26514545,26516080-26516302                       36   0.043
05_02_0053 - 6152204-6152329,6152817-6152981,6154698-6154883,615...    36   0.057
03_06_0089 - 31565454-31565517,31565594-31565618,31565743-315659...    35   0.076
07_03_0550 - 19356710-19357763,19358941-19359256,19359552-19359609     34   0.13 
05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751     34   0.17 
04_04_1575 + 34548774-34549109,34549979-34550185                       33   0.23 
01_06_1771 + 39787895-39788223,39788419-39788518,39788640-39788774     33   0.23 
07_03_1717 - 28958309-28958581,28958678-28958842,28958944-289591...    33   0.30 
12_01_0468 + 3661177-3661626                                           33   0.40 
01_01_0474 - 3488739-3488876,3488996-3489118,3489878-3489991,349...    32   0.70 
03_06_0330 - 33178114-33178206,33178317-33178382,33179704-331798...    31   1.2  
05_01_0489 - 4077365-4077502,4078105-4078227,4079019-4079135,407...    31   1.6  
03_06_0376 + 33479776-33479958,33481055-33481236,33481345-334814...    31   1.6  
08_02_0497 - 17811413-17811529,17811644-17811724,17812693-178128...    30   2.1  
10_08_0426 - 17817975-17818582,17819068-17819209,17819648-178197...    30   2.8  
03_02_0863 - 11889492-11889761,11890257-11890421,11890518-11890637     30   2.8  
01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956,647...    30   2.8  
03_04_0011 + 16398093-16398170,16401321-16401806,16401892-164023...    29   3.8  
03_01_0480 - 3676529-3676687,3676767-3676931,3677044-3677220,367...    29   3.8  
12_02_1175 + 26702744-26704507                                         29   6.6  
05_07_0096 - 27663415-27664086                                         29   6.6  
04_03_0975 - 21370715-21370877,21371227-21371319,21371383-213714...    29   6.6  
03_02_0621 - 9923163-9923245,9924163-9924338,9924437-9924495,992...    29   6.6  
03_05_0175 + 21513767-21513903,21534361-21535385,21537375-215375...    28   8.7  
02_05_0792 - 31777775-31778220,31778506-31778630,31778724-317789...    28   8.7  
02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952     28   8.7  

>11_01_0618 -
           4941906-4942118,4942231-4942343,4942534-4942651,
           4942762-4942881,4942964-4943101,4943392-4943517,
           4943659-4943847,4943951-4944238,4944344-4944374,
           4945014-4945216
          Length = 512

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQEQD--LAESYGVRGYPTLKFFRN-GSPI-DYSGGRQADDIISWLKKKTG 426
           PI LAKVDA  E++  LA  Y ++G+PTLK FRN G  I +Y G R+A+ I+ +LKK+ G
Sbjct: 92  PIVLAKVDANDEKNKPLATKYEIQGFPTLKIFRNQGKNIQEYKGPREAEGIVEYLKKQVG 151

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P + E+ S E A  LID   + + G F
Sbjct: 152 PASKEIKSPEDATNLIDDKKIYIVGIF 178



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 33/74 (44%), Positives = 43/74 (58%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLT 283
           E VL L    F+  +    +++VEFYAPWCGHCK LAPEY KAA +L++ D      K+ 
Sbjct: 40  EAVLTLDADGFDEAVAKHPFMVVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVD 99

Query: 284 QLKNRISPRATVYE 325
               +  P AT YE
Sbjct: 100 ANDEKNKPLATKYE 113



 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 25/55 (45%), Positives = 34/55 (61%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           EV  E   +V++    + V  + + +LVEFYAPWCGHCK LAP   +AAT L  +
Sbjct: 380 EVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKLAPILDEAATTLKSD 434



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR-NGSPIDYSGGRQADDIISWLK--KKTGPP 432
           + +AK+DAT   D+   + V+GYPTL F   +G  + Y  GR AD+I+ ++K  K+T   
Sbjct: 437 VVIAKMDATAN-DVPSEFDVQGYPTLYFVTPSGKMVPYESGRTADEIVDFIKKNKETAGQ 495

Query: 433 AVEVTSAEQAKELID 477
           A E   +  A+ L D
Sbjct: 496 AKEKAESAPAEPLKD 510


>02_01_0001 -
           3864-4049,4861-4917,5514-5648,5710-5808,5884-5952,
           6419-6493,6619-6705,6873-6953,7021-7163,7262-7430,
           7538-7667,7753-8255
          Length = 577

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 31/71 (43%), Positives = 51/71 (71%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAKVDAT++ DLA+ Y V+G+PT+ FF +G P DY+G R  + I+SW+ KK  P    
Sbjct: 126 VALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPKDYNGARTKEAIVSWVNKKLAPGVQN 185

Query: 442 VTSAEQAKELI 474
           +T+ ++A++++
Sbjct: 186 ITTVDEAEKIL 196



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 25/49 (51%), Positives = 36/49 (73%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           E +V +LS ANF   + +  +++VEFYAPWC HC++LAP+YA AA  L+
Sbjct: 72  ETHVFLLSAANFSDFLASHRHVMVEFYAPWCAHCQALAPDYAAAAADLS 120



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +2

Query: 173 EFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           + YAPWCGHC+ L P Y K    L   D L
Sbjct: 452 KIYAPWCGHCQELEPTYNKLGKHLRGIDSL 481


>04_03_1011 -
           21708503-21708544,21708689-21708898,21709000-21709112,
           21709232-21709349,21709386-21709412,21709671-21709808,
           21710069-21710194,21710279-21710467,21710598-21710885,
           21710937-21711024,21711120-21711298
          Length = 505

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 37/87 (42%), Positives = 56/87 (64%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQEQ--DLAESYGVRGYPTLKFFRNG-SPI-DYSGGRQADDIISWLKKKTG 426
           P+ LAKVDA  E+  +L + YGV  YPT+K  +NG S +  Y G R+AD I+ +LK++ G
Sbjct: 103 PVVLAKVDAYNERNKELKDKYGVYSYPTIKIMKNGGSDVRGYGGPREADGIVEYLKRQVG 162

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P ++++ SAE+A   +    VI+ G F
Sbjct: 163 PASLKLESAEEAAHSVVDKGVILVGVF 189



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 27/62 (43%), Positives = 40/62 (64%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           + +LI ++   +G+   +E+  +E VL L   NF  V+    +I+V+FYAPWCGHCK LA
Sbjct: 11  LAILISSSPTAVGVDATEEL--KEAVLTLDAGNFSEVVAKHPFIVVKFYAPWCGHCKQLA 68

Query: 215 PE 220
           PE
Sbjct: 69  PE 70



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWLKKKTGPPAV 438
           I +AK+D T   D+   + V GYPT+ F+ + G+ + Y G R A++IIS++ +  GP A 
Sbjct: 417 IVIAKMDGTVN-DIPTDFTVEGYPTIYFYSSSGNLLSYDGARTAEEIISFINENRGPKAG 475

Query: 439 EVTSAEQAKELIDA 480
              + ++ K  IDA
Sbjct: 476 AAAAVDE-KTQIDA 488



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++ V V+   N + ++  + + +L+EFYAPWCGHC+  A    + A  L ++
Sbjct: 363 DQPVKVVVADNIDDIVFNSGKNVLLEFYAPWCGHCRKFALILEEIAVSLQDD 414


>02_04_0214 -
           20976977-20977171,20977499-20977611,20978041-20978158,
           20978585-20978701,20978836-20978973,20979193-20979318,
           20979827-20980015,20980539-20980863,20980977-20981134
          Length = 492

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 34/67 (50%), Positives = 38/67 (56%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           A ALL LA        E VL L   NF  V+   ++I+VEFYAPWCGHC  LAPEY  AA
Sbjct: 10  AFALLLLA-SSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAAA 68

Query: 236 TKLAEED 256
             L   D
Sbjct: 69  AALRSHD 75



 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISWLKKKTG 426
           P+ LAKVDA+ +  + LA  +GV+GYPT++  R+      +Y+G R A  I+++LK++ G
Sbjct: 77  PVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGIVAYLKRQAG 136

Query: 427 PPAVEV--TSAEQAKELIDANTVIVFGFF 507
           P +VE+  +++  A + I  + V+V G F
Sbjct: 137 PASVEIAASASPPAADSIANDGVVVVGVF 165



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 18/40 (45%), Positives = 27/40 (67%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           E V  + + +L+EFYAPWCGHC+ LAP   + A  L +++
Sbjct: 382 EVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDE 421


>04_03_0988 -
           21469811-21469831,21470823-21471047,21471327-21471634,
           21471864-21472234,21472327-21472430,21473086-21473325
          Length = 422

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 28/69 (40%), Positives = 42/69 (60%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           +L+  +      A  +E P +  V+ L +++FE  +   +Y+ V+FYAPWCGHCK LAPE
Sbjct: 21  LLLLLSFHAAAAAAAEEFPRDGRVIELDESSFEAALGAIDYLFVDFYAPWCGHCKRLAPE 80

Query: 221 YAKAATKLA 247
             +AA  LA
Sbjct: 81  LDEAAPVLA 89



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           PI +AKV+A + + L   YGV G+PTL  F +G PI+Y+G R+AD ++  L K   P   
Sbjct: 94  PIIVAKVNADKYRKLGSKYGVDGFPTLMLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVS 153

Query: 439 EVTSAEQAKELID 477
            + S    K  ++
Sbjct: 154 ILESDSAIKSFVE 166


>06_01_0452 +
           3198475-3198962,3199062-3199191,3199332-3199497,
           3199765-3199883,3200056-3200136,3200236-3200322,
           3200644-3200715,3200791-3200859,3201349-3201426,
           3201540-3201680,3202333-3202386,3202465-3202581
          Length = 533

 Score = 64.9 bits (151), Expect = 8e-11
 Identities = 28/84 (33%), Positives = 47/84 (55%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S +  AK+D  +    A + GV+G+PT+  F NG+   ++G    D I++W++KKTG PA
Sbjct: 119 SAVAFAKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPA 178

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             + S + A+E +  +     G F
Sbjct: 179 SRIQSKDSAEEFLKKDQTFAVGLF 202



 Score = 36.3 bits (80), Expect = 0.033
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           VLVL   N    +     +L+  YAPWC     L P +A+AA  L
Sbjct: 70  VLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAAL 114



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = +2

Query: 86  DEVPTEENVL--VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           + VP E+  +  V+ +    +V+ + + + +E +APWC  C++++    K A
Sbjct: 399 EPVPEEKGPIEKVVGRTFDSSVLESPQNVFLEVHAPWCVDCEAISKNVEKLA 450


>01_03_0161 +
           13337265-13337297,13337880-13338017,13338211-13338308,
           13338395-13338450,13338664-13338781,13338889-13338916,
           13339021-13339112,13339321-13339477,13339569-13339693,
           13339785-13339884,13339991-13340059
          Length = 337

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426
           + +A +DA + +DLAE YGV GYPTLKFF  G+    DY GGR+ DD + ++ +K G
Sbjct: 172 VVIANLDADKHKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCG 228



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+VL   NF++++    + ILVEFYAPWCGHCK LAP Y K A+    +D
Sbjct: 120 SVVVLGPDNFDSIVLDENKDILVEFYAPWCGHCKHLAPIYEKLASVYKLDD 170



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           +AKVD  + + +   YGV GYPT+++F  GS  P  Y G R A+ +  ++  + G
Sbjct: 55  IAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFVNTEGG 109



 Score = 31.9 bits (69), Expect = 0.70
 Identities = 12/17 (70%), Positives = 12/17 (70%)
 Frame = +2

Query: 179 YAPWCGHCKSLAPEYAK 229
           Y   CGHCK LAPEY K
Sbjct: 26  YLVRCGHCKKLAPEYEK 42


>05_01_0410 -
           3234455-3234466,3234851-3234950,3235037-3235161,
           3235244-3235400,3235644-3235735,3235828-3235855,
           3235949-3236066,3236411-3236466,3236556-3236653,
           3236864-3236948,3237428-3237600
          Length = 347

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           R  + + + L+  A      + ++VL L+++ FE  +      LVEFYAPWCGHCK LAP
Sbjct: 8   RKALASLLLLVAAAAAVSTASADDVLALTESTFEKEVGQDRAALVEFYAPWCGHCKKLAP 67

Query: 218 EYAK--AATKLAEEDLLS 265
           EY K  A+ K A+  L++
Sbjct: 68  EYEKLGASFKKAKSVLIA 85



 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426
           + +A +DA +   LAE YGV G+PTLKFF  G+    DY GGR+ DD + ++ +K G
Sbjct: 201 VVIANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYDGGRELDDFVKFINEKCG 257



 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 1/51 (1%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+VL+   F++V+   T+ +LVEFYAPWCGHCK LAP Y K A+   +++
Sbjct: 149 SVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCKHLAPIYEKLASVYKQDE 199



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKK 420
           + +AKVD  + + +   YGV GYPT+++F  GS  P  Y G R A+ +  ++  +
Sbjct: 82  VLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYVNSE 136


>02_04_0182 +
           20719782-20720033,20720502-20720605,20720693-20721066,
           20721302-20721609,20721853-20722092
          Length = 425

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           +PI +AKV+A + + L   YGV G+PTL  F +G+P +Y+G R+AD ++  LKK   P  
Sbjct: 97  TPIVVAKVNADKYKKLGSKYGVDGFPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDV 156

Query: 436 VEVTSAEQAKELID 477
             + S    K  ++
Sbjct: 157 SVLESDSAIKSFVE 170



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 24/53 (45%), Positives = 33/53 (62%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           ++P +  VL L   NF+  +     + V+FYAPWCGHCK LAP+  +AA  LA
Sbjct: 41  QIPRDGRVLELDDGNFDAAVRAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLA 93


>09_04_0345 +
           16876489-16876614,16876718-16876876,16877989-16878102,
           16878701-16878882,16879142-16879241,16879597-16879638,
           16879818-16879994,16880084-16880175,16880633-16880779,
           16880832-16881036
          Length = 447

 Score = 58.0 bits (134), Expect = 9e-09
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)
 Frame = +2

Query: 83  GDEVPTEENVLV-LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           G    TE +  + L+  NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA  L
Sbjct: 157 GSSEKTEPSASIELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNL 212



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 21/43 (48%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           VL  +  NF++ V+ +   +LVEF+APWCGHC+ L P + KAA
Sbjct: 31  VLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAA 73



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +1

Query: 241 AG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISW 408
           AG  +    +A +DA   ++LA+ YG+RG+PT+K F  G  P+DY G R    I+ +
Sbjct: 73  AGVLKGVATVAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEF 129


>07_03_0651 +
           20287661-20287701,20288034-20288124,20288737-20288831,
           20289433-20289523,20290066-20290250,20290590-20290647,
           20290812-20290852,20290935-20291009,20292298-20292354,
           20292480-20292546,20292754-20292900,20292986-20293210,
           20293332-20293493,20293570-20293647,20293735-20293812
          Length = 496

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 18/40 (45%), Positives = 27/40 (67%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           I LAKVD T+E DL   + ++GYP+++ FR GS +  + G
Sbjct: 210 IILAKVDCTEEIDLCRRHHIQGYPSIRIFRKGSDLKENQG 249



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = +2

Query: 83  GDEVPT--EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           GD+V    ++  + LS  NF++       ++V FYAPWC     L P + K A  + E
Sbjct: 143 GDDVEENHDDGSVPLSSRNFDSYSHQYPVLVVNFYAPWCYWSNRLKPSWEKTAKIMRE 200


>07_01_0621 - 4606739-4606894,4606976-4607098,4608199-4608288
          Length = 122

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTS 450
           KVD  + +++AE Y V   PT  F ++G+  D   G + DD+ + + K  G  A   ++
Sbjct: 64  KVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA 122



 Score = 35.1 bits (77), Expect = 0.076
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 6/53 (11%)
 Frame = +2

Query: 101 EENVLVL--SKANFETVITTTE----YILVEFYAPWCGHCKSLAPEYAKAATK 241
           EE V++   +K  F+  +T  +     ++++F A WCG C+ +AP +A+ A K
Sbjct: 4   EEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKK 56


>07_01_0656 - 4912985-4913143,4913700-4913822,4914081-4914215
          Length = 138

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 77  ALGDEVPTEENVLVLSKANFETVI----TTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           A G+E      V V SKA ++ +      TT+ ++++F A WCG CK + P + + A + 
Sbjct: 13  AAGEEGGESAVVAVHSKAKWDELWDAHKNTTKLVVIDFSASWCGPCKMMEPVFKEMAGRF 72

Query: 245 AE 250
            +
Sbjct: 73  TD 74


>02_05_0085 -
           25697860-25698142,25698631-25698946,25700481-25700518,
           25700955-25701036,25701815-25702016
          Length = 306

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAK 229
           ++K+ +++++  +E  +LVEF+A WCG CK + P   K
Sbjct: 111 VTKSTWQSLVVESELPVLVEFWASWCGPCKMIDPVIGK 148



 Score = 34.7 bits (76), Expect = 0.100
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEVTS 450
           K++  +  D+A  +G+R  PT+  F+NG   D   G      ++S + K  G    E ++
Sbjct: 161 KLNTDENPDIATQFGIRSIPTMMIFKNGEKKDAVIGAVPESTLVSSIDKYIGR---ETST 217

Query: 451 AEQAKELID 477
            + A++++D
Sbjct: 218 QDLAEQVVD 226


>10_08_0532 +
           18580579-18580746,18581923-18581997,18582659-18583887,
           18584853-18585013,18585272-18585279,18587737-18588768
          Length = 890

 Score = 36.3 bits (80), Expect = 0.033
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           +V+A ++ +++E+YGV   P   F + G  +D   G     + + + K  GP +V
Sbjct: 56  RVEAEEQPEISEAYGVTAVPYFVFLKEGKTVDTLEGANPASLANKVAKLAGPASV 110


>04_04_0598 - 26514226-26514545,26516080-26516302
          Length = 180

 Score = 35.9 bits (79), Expect = 0.043
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           +K  K++  +  D+A  YGVR  PT+  F+NG   D
Sbjct: 124 LKCYKLNTDENPDIASQYGVRSIPTMMIFKNGEKKD 159



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAK 229
           T   V  ++K+ +++++  +E  +LV ++A WCG CK + P   K
Sbjct: 71  TSIQVPEVTKSTWQSLVMESELPVLVGYWATWCGPCKMIDPVVGK 115


>05_02_0053 -
           6152204-6152329,6152817-6152981,6154698-6154883,
           6155055-6155078,6155649-6155822
          Length = 224

 Score = 35.5 bits (78), Expect = 0.057
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++VEFY  WCG C++L P   + A +
Sbjct: 110 VIVEFYGTWCGSCRALFPRLCRTAVE 135


>03_06_0089 -
           31565454-31565517,31565594-31565618,31565743-31565927,
           31566302-31566405,31567148-31567366,31567721-31567903
          Length = 259

 Score = 35.1 bits (77), Expect = 0.076
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           L  +   +E  ++  +  +VEFYA WC  C+ LAP+  K
Sbjct: 125 LAANATPYEEALSNGKPTVVEFYADWCEVCRELAPDVYK 163


>07_03_0550 - 19356710-19357763,19358941-19359256,19359552-19359609
          Length = 475

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           G A   ++     V+ L++A  E ++   +  E  LV  YAPWC  C+++   Y + A +
Sbjct: 350 GSAGAPDIFESSGVVSLTRAGVENLLRLESRAEPWLVVLYAPWCPFCQAMEASYLELAER 409

Query: 242 L 244
           L
Sbjct: 410 L 410


>05_06_0017 + 24964168-24964275,24965384-24965506,24965617-24965751
          Length = 121

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           E   +  + ++++F A WCG C+ +AP +A  A K
Sbjct: 28  EEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKK 62



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 414
           KVD  + + +AE + V   PT  F + G   D   G   D++ S L+
Sbjct: 70  KVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLE 116


>04_04_1575 + 34548774-34549109,34549979-34550185
          Length = 180

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           V  + ++ FE  +  ++  +LV+F A WCG C+ +AP
Sbjct: 69  VRFIGQSEFEAEVLQSDLPVLVDFVADWCGPCRLIAP 105



 Score = 29.9 bits (64), Expect = 2.8
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366
           +K+ K+D      L E Y V G P+L  F++G  +
Sbjct: 118 LKIVKIDHDANPQLIEEYKVYGLPSLILFKDGKEV 152


>01_06_1771 + 39787895-39788223,39788419-39788518,39788640-39788774
          Length = 187

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +2

Query: 77  ALGDEVPTEENVLVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           A  + V     V  ++K  F  ++ +   + ++++ Y  WCG CK +AP++ + + K
Sbjct: 71  AEAEAVAVTGQVTEVNKDTFWPIVKSAGPKVVVLDMYTQWCGPCKVMAPKFQEMSEK 127


>07_03_1717 -
           28958309-28958581,28958678-28958842,28958944-28959120,
           28959315-28959539
          Length = 279

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V+F++P CG C++L P+ A+ A K  E
Sbjct: 116 VVVDFFSPGCGGCRALHPKIAQLAEKNPE 144


>12_01_0468 + 3661177-3661626
          Length = 149

 Score = 32.7 bits (71), Expect = 0.40
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)
 Frame = +3

Query: 582 VSDEKVIKELEAEDEDVVLFKNFEEKR--VKYXDEEITEDLLNALGVVQSM 728
           + +E+V++E E E E+  + +  EE R  V+   EE+ E+   A GVVQSM
Sbjct: 80  IEEEEVVEEEEEEIEEEEVKEEEEELREQVQEAGEEVNEEQQGADGVVQSM 130


>01_01_0474 -
           3488739-3488876,3488996-3489118,3489878-3489991,
           3490416-3490452,3490584-3490675,3490878-3490956,
           3491640-3491734,3491858-3491991,3492560-3492833,
           3493743-3494015,3494976-3495512
          Length = 631

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%)
 Frame = +2

Query: 107 NVLVLS-KANFETVITTT----EYILVEFYAPWCGHCKSLAPEYAK 229
           NV V+S K N++  I       + ++  F A WCG C+ +AP YA+
Sbjct: 522 NVHVISNKENWDHKIAEANKDGKIVIANFSAAWCGPCRVIAPVYAE 567



 Score = 29.1 bits (62), Expect = 5.0
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           +D  +  D + S+ +R  PT  F +NG  +D
Sbjct: 580 IDVDELMDFSSSWDIRATPTFFFLKNGEQVD 610


>03_06_0330 -
           33178114-33178206,33178317-33178382,33179704-33179826,
           33179930-33180067
          Length = 139

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           I+++F A WCG C+ + P +   A + A+
Sbjct: 47  IVIDFSATWCGPCRFIEPAFKDMAGRFAD 75


>05_01_0489 -
           4077365-4077502,4078105-4078227,4079019-4079135,
           4079243-4079263
          Length = 132

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAK 229
           ++  F A WCG C+ +AP YA+
Sbjct: 47  VVANFSASWCGPCRVIAPIYAE 68


>03_06_0376 +
           33479776-33479958,33481055-33481236,33481345-33481469,
           33481858-33482057,33482629-33482762,33483095-33483158,
           33483764-33484441,33484723-33484839
          Length = 560

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = +1

Query: 301 LAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           L   YGVRG+P +      + + Y G +    ++ + K+ TG
Sbjct: 123 LFSRYGVRGFPAILLVNETTMVRYWGPKDLSSLVDFYKETTG 164


>08_02_0497 -
           17811413-17811529,17811644-17811724,17812693-17812815,
           17812945-17813193
          Length = 189

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFF 348
           KVD   E +LA    VRG PTL FF
Sbjct: 137 KVDTDDEYELARDMQVRGLPTLYFF 161



 Score = 29.5 bits (63), Expect = 3.8
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++V+FYA WCG C  +A +    A +
Sbjct: 103 LIVDFYATWCGPCVLMAQDIEMLAVE 128


>10_08_0426 -
           17817975-17818582,17819068-17819209,17819648-17819745,
           17820070-17821897,17822331-17822738,17822891-17822943,
           17823461-17823877,17824401-17824605
          Length = 1252

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           VL++ANF + I    +IL+    PW G  +SL  E
Sbjct: 45  VLTRANFSSQIRLHPHILLVVTMPWYGESRSLMAE 79


>03_02_0863 - 11889492-11889761,11890257-11890421,11890518-11890637
          Length = 184

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 9/24 (37%), Positives = 18/24 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAA 235
           ++V+F++P CG C++L P+  + A
Sbjct: 22  VIVDFFSPGCGGCRALHPKICQIA 45


>01_01_0829 +
           6471032-6471870,6472490-6472685,6472772-6472956,
           6473206-6473539,6473629-6473833,6474927-6475033,
           6475117-6475269
          Length = 672

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366
           R   I   KVD ++   +A +  VR  PT K ++NG+ +
Sbjct: 614 RYPSISFLKVDISESPAVARAENVRTVPTFKIYKNGTRV 652


>03_04_0011 +
           16398093-16398170,16401321-16401806,16401892-16402380,
           16402810-16403466
          Length = 569

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +L+ F A WCG C++  P+      K+ E+
Sbjct: 362 VLLYFSAKWCGPCRAFLPKLVDEYNKIKEK 391


>03_01_0480 -
           3676529-3676687,3676767-3676931,3677044-3677220,
           3678170-3678273,3678700-3678843,3679831-3679898,
           3680059-3680162,3680759-3680767,3681572-3681657,
           3681918-3683373
          Length = 823

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           + ++ + +  +V F++P CG CK+L P+  + A
Sbjct: 689 QLLLASDKLTVVHFFSPSCGACKALHPKVCQLA 721


>12_02_1175 + 26702744-26704507
          Length = 587

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = -3

Query: 326 PRTP*LSARSCS*VASTFASLIGDLLQPALLLPWRIPVPEICSGR 192
           P  P  S+   +    TFA  + DLL   L LP R+ +P+I + R
Sbjct: 314 PPLPVSSSSKPTSAPRTFARRLVDLLHSPLYLPRRLTIPDIAAHR 358


>05_07_0096 - 27663415-27664086
          Length = 223

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 10/93 (10%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW--------- 408
           SP +LA++D  Q + +AE  G+     L    +G+ +   GG   D I+           
Sbjct: 119 SPSQLAQIDDLQRRTVAEEDGLSREMALVQEGHGA-VAVGGGIDVDGIVGRVRGVLGRAD 177

Query: 409 -LKKKTGPPAVEVTSAEQAKELIDANTVIVFGF 504
            L+ +T   AVE+    QA EL+ A   +  GF
Sbjct: 178 ALRLRTVKRAVEILEPAQAAELLVAAADMEIGF 210


>04_03_0975 -
           21370715-21370877,21371227-21371319,21371383-21371466,
           21371745-21371869,21372360-21372600,21373640-21373734
          Length = 266

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCK 205
           +L+EF+A WCG C+
Sbjct: 36  VLIEFWASWCGPCR 49


>03_02_0621 -
           9923163-9923245,9924163-9924338,9924437-9924495,
           9924952-9924984,9925060-9925185
          Length = 158

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSL 211
           V+F  PWC HCK+L
Sbjct: 63  VKFCVPWCKHCKNL 76


>03_05_0175 +
           21513767-21513903,21534361-21535385,21537375-21537547,
           21537849-21538679
          Length = 721

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +3

Query: 582 VSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEEITEDLLNA 707
           V +E+V +E E E+E+V      EE+ ++  +EE+ E++  A
Sbjct: 58  VEEEEVEEEEEIEEEEVEEEIEEEEEEIEEEEEEVREEVQEA 99


>02_05_0792 -
           31777775-31778220,31778506-31778630,31778724-31778911,
           31779716-31779892
          Length = 311

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +2

Query: 83  GDEVPT-EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           GD V   E + + L+KA     +   +YI V FYA WC   +   P +
Sbjct: 52  GDPVGVIEGDEVTLAKAITLLHMNKDDYIAVLFYASWCPFSQECKPNF 99


>02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952
          Length = 206

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +1

Query: 277 VDATQEQ-DLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           +D   EQ ++A+   ++  P   F++NG  ++    R  + II+ ++K T P
Sbjct: 149 IDEYDEQSEVADRLRIKVVPLFHFYKNGVLLEAFATRDKERIIAAIQKYTAP 200


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,285,903
Number of Sequences: 37544
Number of extensions: 473832
Number of successful extensions: 1175
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 1096
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1167
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2506954360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -