SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1057 + 27248249-27249001                                        104   8e-23
02_01_0529 - 3846489-3847268                                          103   3e-22
03_02_0380 - 7945959-7946699                                          100   3e-21
09_04_0535 + 18397051-18397644                                         91   8e-19
08_01_0702 - 6205731-6206516,6207521-6207549,6208135-6208150           91   1e-18
08_02_1128 + 24510735-24511055                                         60   2e-09
01_01_0018 + 139150-140415                                             55   7e-08
01_05_0464 - 22470963-22472291                                         55   9e-08
04_04_1632 - 34926955-34927332                                         54   2e-07
05_03_0410 + 13616708-13617691                                         52   6e-07
10_02_0162 + 6054823-6055830                                           51   1e-06
01_03_0204 + 13771346-13772680                                         51   1e-06
11_06_0022 + 19321886-19321918,19323059-19323131,19323587-193236...    44   1e-04
05_05_0328 + 24130887-24130919,24132207-24132279,24133542-241336...    44   2e-04
01_01_0592 + 4414416-4415132                                           44   2e-04
03_06_0710 + 35676497-35677204,35677837-35677921,35679722-35679798     31   0.94 
06_01_0582 + 4172154-4173614                                           29   3.8  
01_03_0040 + 11888291-11888419,11888525-11888662,11888913-118890...    28   8.8  

>06_03_1057 + 27248249-27249001
          Length = 250

 Score =  104 bits (250), Expect = 8e-23
 Identities = 52/74 (70%), Positives = 60/74 (81%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           LQQFW + L DI++    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FAKA EIFI 
Sbjct: 80  LQQFWAERLVDIEQTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVIFAKACEIFIL 137

Query: 475 ELTLRAWSHTEEIK 516
           ELTLR+W HTEE K
Sbjct: 138 ELTLRSWMHTEENK 151



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D +DFL+DIVPR ++K
Sbjct: 163 AITRTDMYDFLVDIVPRDDLK 183


>02_01_0529 - 3846489-3847268
          Length = 259

 Score =  103 bits (246), Expect = 3e-22
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q L++FW   +E+I++    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FAKA E+F
Sbjct: 82  QQLREFWANQMEEIEQTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFAKACEVF 139

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W HTEE K
Sbjct: 140 ILELTLRSWMHTEENK 155



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/21 (57%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D +DFL+DIVPR E+K
Sbjct: 167 AITRTDIYDFLVDIVPRDEMK 187


>03_02_0380 - 7945959-7946699
          Length = 246

 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/74 (62%), Positives = 57/74 (77%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           LQ FW    ++ ++ ++ DFK   LPLARIKKIMK DE+V+MISAEAPVLFAKA E+FI 
Sbjct: 46  LQAFWAYQRQEAERASASDFKNHQLPLARIKKIMKADEDVRMISAEAPVLFAKACELFIL 105

Query: 475 ELTLRAWSHTEEIK 516
           ELT+R+W H EE K
Sbjct: 106 ELTIRSWLHAEENK 119



 Score = 33.1 bits (72), Expect = 0.31
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D FDFL+DIVPR E K
Sbjct: 131 AIARTDVFDFLVDIVPREEAK 151



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 441 LIREGC*DFYTRANVASLVAYGGNKRRTLQRNDIA 545
           L  + C  F     + S +    NKRRTLQRND+A
Sbjct: 95  LFAKACELFILELTIRSWLHAEENKRRTLQRNDVA 129


>09_04_0535 + 18397051-18397644
          Length = 197

 Score = 91.5 bits (217), Expect = 8e-19
 Identities = 45/76 (59%), Positives = 55/76 (72%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW +   +I+     DFK   LPLARIKKIMK DE+V+MI+AEAPV+FA+A E+F
Sbjct: 58  QQLQMFWAEQYREIEATT--DFKNHNLPLARIKKIMKADEDVRMIAAEAPVVFARACEMF 115

Query: 469 IHELTLRAWSHTEEIK 516
           I ELT R W+H EE K
Sbjct: 116 ILELTHRGWAHAEENK 131



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 11/21 (52%), Positives = 17/21 (80%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I +++ FDFL+DIVPR + K
Sbjct: 143 AIARTEVFDFLVDIVPRDDAK 163


>08_01_0702 - 6205731-6206516,6207521-6207549,6208135-6208150
          Length = 276

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 42/74 (56%), Positives = 56/74 (75%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           + LQ FW   + +++++   +FK   LPLARIKKIMK DE+VKMI+ EAP LFAKA E+F
Sbjct: 104 EQLQAFWADQMAEVEQMT--EFKLPNLPLARIKKIMKADEDVKMIAGEAPALFAKACEMF 161

Query: 469 IHELTLRAWSHTEE 510
           I ++TLR+W HTEE
Sbjct: 162 ILDMTLRSWQHTEE 175


>08_02_1128 + 24510735-24511055
          Length = 106

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 27/41 (65%), Positives = 34/41 (82%)
 Frame = +1

Query: 394 MKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           MK DE+V+MI+AEAPV+FA+A E+FI ELT R W+H EE K
Sbjct: 1   MKADEDVRMIAAEAPVVFARACEMFILELTHRGWAHAEENK 41



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAP 649
           +I +++ FDFL+DIVPR E K  +     A   P
Sbjct: 53  AIARTEVFDFLVDIVPRDEAKDAEAAAAVAAGIP 86


>01_01_0018 + 139150-140415
          Length = 421

 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/73 (32%), Positives = 43/73 (58%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q + +FW    ++I+   ++DF   A+P+AR+KKI    +   M+S + P   +K  E+F
Sbjct: 20  QQMDEFWRDRQKEIE--TTKDFSEHAIPMARLKKIASSQKGNMMMSFDMPAFLSKMCELF 77

Query: 469 IHELTLRAWSHTE 507
           + EL +RAW+  +
Sbjct: 78  VQELAVRAWASAQ 90


>01_05_0464 - 22470963-22472291
          Length = 442

 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q + +FW    ++I+   ++DF   A+P+AR+KKI+   +   M++ + P   +K  E+F
Sbjct: 20  QQMDEFWRDRQKEIE--TTKDFSEHAIPMARLKKIVSSQKGNMMMTFDMPAFLSKMCELF 77

Query: 469 IHELTLRAWSHTE 507
           + EL +RAW+  +
Sbjct: 78  VQELAVRAWASAQ 90


>04_04_1632 - 34926955-34927332
          Length = 125

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 14/65 (21%)
 Frame = +1

Query: 364 ALPLARIKKIMKL---DEEV-----------KMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           ALPLARIKKIMK    D  V           +MIS EAPV+F+KA E+FI ELT RAW+ 
Sbjct: 23  ALPLARIKKIMKRSAGDSSVVDGGGGGGGGARMISGEAPVVFSKACELFIAELTRRAWAA 82

Query: 502 TEEIK 516
           T E K
Sbjct: 83  TLEGK 87


>05_03_0410 + 13616708-13617691
          Length = 327

 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 8/134 (5%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           +++FW +  E I+   S       LP+  +K +++   +  M+SA+ P    K  E+F+ 
Sbjct: 31  MEEFWRRSQEQIEA--SAGNHEHILPIDCVKNVIRPKNDAMMLSADTPTFVTKLCELFVQ 88

Query: 475 ELTLRAW----SHTEEIKGGLCSA---TT*RQYIEIGSVRFPDRHSAAA*SQAD-ETALR 630
           ELTLRAW    SH  +I  G   A   TT   Y  +G+V     H A   +  D +T+ R
Sbjct: 89  ELTLRAWVCANSHNRDIILGTDIAEAITTTESYHFLGNVL--RSHKALGSTAPDIDTSAR 146

Query: 631 RRXESPQHGSVLPP 672
           +  +  Q  S+  P
Sbjct: 147 KHIKLDQMTSLYHP 160


>10_02_0162 + 6054823-6055830
          Length = 335

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 4/77 (5%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           +++FW    E I++  S   +   LP++R+K I+   E   M+SA+ P    K  E+F+ 
Sbjct: 31  MEKFWRMSQEQIEE--SAGNEELILPISRVKNIIHAKEGGMMLSADTPAFVTKLCELFVQ 88

Query: 475 ELTLRAW----SHTEEI 513
           EL LRAW    SH  EI
Sbjct: 89  ELILRAWVCANSHNREI 105


>01_03_0204 + 13771346-13772680
          Length = 444

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q + +FW    ++I+   ++DF    +P+AR+KKI+   +   M++ + P   +K  E+F
Sbjct: 20  QQMDEFWRDRQKEIEM--TKDFSEHMIPMARLKKIVSSQKGNMMMTFDMPAFLSKMCELF 77

Query: 469 IHELTLRAWS 498
           + EL  RAW+
Sbjct: 78  VQELAARAWA 87


>11_06_0022 +
           19321886-19321918,19323059-19323131,19323587-19323680,
           19324383-19324499,19324584-19324641,19324713-19325114
          Length = 258

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 30/45 (66%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P ARIKKIM+ DE+V  I+   PVL ++A E+F+ +L  R +  T
Sbjct: 10  PAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDRTYEIT 54


>05_05_0328 +
           24130887-24130919,24132207-24132279,24133542-24133635,
           24133924-24134037,24134121-24134169,24134364-24134873
          Length = 290

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/45 (46%), Positives = 29/45 (64%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P  RIKKIM+ DE+V  I+   PVL +KA E+F+ +L  R +  T
Sbjct: 10  PAPRIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCNRTYDIT 54


>01_01_0592 + 4414416-4415132
          Length = 238

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 6/67 (8%)
 Frame = +1

Query: 310 DKVLEDIQKVNSE----DFKTQ--ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           D+  E +++V  E    D   Q  ALPL R+K+I+++D ++K ++ EA +L A A E+F+
Sbjct: 94  DEATEPMEQVEGEGEDGDAAAQRPALPLGRVKRIIRVDRDIKKVTNEAALLIAAATELFV 153

Query: 472 HELTLRA 492
             L   A
Sbjct: 154 GSLAAGA 160


>03_06_0710 + 35676497-35677204,35677837-35677921,35679722-35679798
          Length = 289

 Score = 31.5 bits (68), Expect = 0.94
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 349 DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           D    + P+AR+++IM+ ++     S EA  L  KA EIF+
Sbjct: 200 DHGAGSFPMARVRQIMRAEDATIRPSNEAVFLINKATEIFL 240


>06_01_0582 + 4172154-4173614
          Length = 486

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -2

Query: 311 SQNCWRVCAPPQRRTPHRQISVHFFGRGNRRCL 213
           +Q CW+V +P  RR   R +S H      RRCL
Sbjct: 430 AQRCWKVPSPVLRRVLRRTVSEHVV-PAYRRCL 461


>01_03_0040 +
           11888291-11888419,11888525-11888662,11888913-11889011,
           11889171-11889557
          Length = 250

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 584 DIVPRHEVKPTKPRYDAAXKAPS 652
           D++PR ++ PTK   DAA K P+
Sbjct: 63  DVIPRWKIVPTKDVIDAAFKDPA 85


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,694,236
Number of Sequences: 37544
Number of extensions: 423030
Number of successful extensions: 1241
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1190
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1238
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2530383840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -