SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0364 - 2834446-2834742,2834838-2835197,2835281-2835562,283...   144   1e-34
10_08_0170 + 15397381-15397418,15397519-15397681,15398419-153986...   138   5e-33
08_02_0657 - 19749835-19751942,19753123-19753561                      108   5e-24
06_01_0646 + 4678422-4678508,4679042-4679123,4679236-4679327,467...    31   1.2  
02_05_0986 - 33334205-33334362,33334487-33334662,33334774-333349...    31   1.2  
06_01_0057 - 483710-484309                                             29   4.9  
05_07_0067 + 27463703-27463705,27464309-27464365,27464779-274648...    28   8.6  
03_05_0339 + 23287620-23287676,23287784-23287849,23287937-232880...    28   8.6  

>03_01_0364 -
           2834446-2834742,2834838-2835197,2835281-2835562,
           2835634-2835705,2835798-2836019,2836105-2836871,
           2837206-2837434,2838027-2838189,2838313-2838350
          Length = 809

 Score =  144 bits (348), Expect = 1e-34
 Identities = 95/224 (42%), Positives = 123/224 (54%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVL+DD C + KIRM             DVVS+  CP VKYGKRVHIL
Sbjct: 65  LLKGKKRKDTICIVLADDTCEEPKIRMNKVVRKNLRVRLGDVVSVHQCPDVKYGKRVHIL 124

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLF+ +LKPYF+EAYRP+ + D F   G      S   K I    A + 
Sbjct: 125 PIDDTVEGITGNLFDAFLKPYFLEAYRPLRKGDLFLVRGG---MRSVEFKVIETDPAEYC 181

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           ++   T         K+     L  +    V  V    AQI+E+VELPLR    + + + 
Sbjct: 182 IVAPDTEIFCDGEPIKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHP-QLFKSIG 240

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K P+GIL ++G   +GK T     +  ETGA  FLINGP IMS
Sbjct: 241 VKPPKGIL-LYGPPGSGK-TLIARAVANETGAFFFLINGPEIMS 282



 Score =  111 bits (267), Expect = 7e-25
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMR+VEFKV+ETDP+ +CIVAPDT I CDGEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 161 VRGGMRSVEFKVIETDPAEYCIVAPDTEIFCDGEPIKREDEER-LDEVGYDDVGGVRKQM 219

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IGVK   +     GPP + K   +ARAVAN    FF
Sbjct: 220 AQ---IRELVELPLRHPQLFKSIGVK-PPKGILLYGPPGSGKT-LIARAVANETGAFF 272



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 41/65 (63%), Positives = 51/65 (78%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           +D K   D STAIL RK  PNRL+V+EA +DDNSV+ +    ME+LQLFRGDTVLLKGK+
Sbjct: 11  SDPKGKKDFSTAILERKKSPNRLVVDEATNDDNSVIGMHPDTMEKLQLFRGDTVLLKGKK 70

Query: 242 RKETV 256
           RK+T+
Sbjct: 71  RKDTI 75


>10_08_0170 +
           15397381-15397418,15397519-15397681,15398419-15398647,
           15398777-15399543,15399650-15399871,15399961-15400032,
           15400100-15400408,15400491-15400850,15401199-15401492
          Length = 817

 Score =  138 bits (334), Expect = 5e-33
 Identities = 89/224 (39%), Positives = 125/224 (55%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVL+D+ C + KIRM             DVVS+  C  VKYGKRVHIL
Sbjct: 65  LLKGKKRKDTICIVLADETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHIL 124

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLF+ +LKPYF+EAYRP+ + D F   G       K  +     +   +
Sbjct: 125 PIDDTVEGITGNLFDAFLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPTEYC--I 182

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +  +   ++++ +   L  +    V  V    AQI+E+VELPLR    + + + 
Sbjct: 183 VAPDTEIFCDGEPIKREDEE-RLDEVGYDDVGGVRKQMAQIRELVELPLRHP-QLFKSIG 240

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K P+GIL ++G   +GK T     +  ETGA  FLINGP IMS
Sbjct: 241 VKPPKGIL-LYGPPGSGK-TLIARAVANETGAFFFLINGPEIMS 282



 Score =  111 bits (267), Expect = 7e-25
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMR+VEFKV+ETDP+ +CIVAPDT I CDGEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 161 VRGGMRSVEFKVIETDPTEYCIVAPDTEIFCDGEPIKREDEER-LDEVGYDDVGGVRKQM 219

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IGVK   +     GPP + K   +ARAVAN    FF
Sbjct: 220 AQ---IRELVELPLRHPQLFKSIGVK-PPKGILLYGPPGSGKT-LIARAVANETGAFF 272



 Score = 93.1 bits (221), Expect = 3e-19
 Identities = 45/65 (69%), Positives = 52/65 (80%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD K   D STAIL RK  PNRL+V+EA +DDNSVVAL    ME+LQLFRGDTVLLKGK+
Sbjct: 11  ADPKGKKDYSTAILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKK 70

Query: 242 RKETV 256
           RK+T+
Sbjct: 71  RKDTI 75


>08_02_0657 - 19749835-19751942,19753123-19753561
          Length = 848

 Score =  108 bits (260), Expect = 5e-24
 Identities = 72/213 (33%), Positives = 109/213 (51%), Gaps = 2/213 (0%)
 Frame = +1

Query: 256 CIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTG 435
           C    D++CPD ++R+             D+V++ PCP+++  KRV + P DDSVEG++G
Sbjct: 79  CYAQKDESCPDGRLRLSRGVRSNLHVRLGDLVTVKPCPTIRNAKRVQLRPFDDSVEGISG 138

Query: 436 NLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWLLIP*YTVTVNR 615
           +LFE YLKPYFM+A RP+ + D F   G       K       +    ++     +  + 
Sbjct: 139 DLFEPYLKPYFMDALRPVKKGDRFLVRGHMHAVEFK-VMDTEPNNEPVIVAGDTEIFCDE 197

Query: 616 LNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE*KLPRGILHVW 789
            +  K+     L       V  V    AQI+E+VELPLR    + + L  + P+GIL ++
Sbjct: 198 GDPVKREDEERLDGPGYDDVGGVRKQLAQIRELVELPLRHP-KLFQTLGVRPPKGIL-LY 255

Query: 790 GRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
           G   TGK T     +  E+GA   ++NGP IMS
Sbjct: 256 GPPGTGK-TLLARAIAAESGAHFVVVNGPEIMS 287



 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 52/121 (42%), Positives = 70/121 (57%), Gaps = 4/121 (3%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPF-CIVAPDTVIHCD-GEPIKREEEEEALNAVGYDDIGGCRK 683
           VRG M AVEFKV++T+P+    IVA DT I CD G+P+KRE+EE  L+  GYDD+GG RK
Sbjct: 164 VRGHMHAVEFKVMDTEPNNEPVIVAGDTEIFCDEGDPVKREDEER-LDGPGYDDVGGVRK 222

Query: 684 QLGAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
           QL        +    + H   F+ +GV+   +     GPP   K   LARA+A  +   F
Sbjct: 223 QLAQ---IRELVELPLRHPKLFQTLGVR-PPKGILLYGPPGTGKT-LLARAIAAESGAHF 277

Query: 858 L 860
           +
Sbjct: 278 V 278



 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 34/63 (53%), Positives = 45/63 (71%), Gaps = 5/63 (7%)
 Frame = +2

Query: 83  DLSTAILR--RKDRPNRLIVEEA---VSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRK 247
           D STAIL   +K  PNRL+ ++A   V+ DNS V LS+A ME+L +FRGD V L+G+RR+
Sbjct: 16  DYSTAILECAKKKSPNRLMADDAEGGVAVDNSTVTLSEATMEELGIFRGDLVTLRGRRRR 75

Query: 248 ETV 256
           E V
Sbjct: 76  EAV 78


>06_01_0646 +
           4678422-4678508,4679042-4679123,4679236-4679327,
           4679441-4679518,4679635-4679696,4680272-4680993,
           4681115-4681272
          Length = 426

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 651 VGYDDIGGCRKQLGAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLA 824
           V Y+D+GGC++Q+        V    +LH   F  +G+    +   C GPP   K   LA
Sbjct: 165 VTYNDVGGCKEQIEKM---REVVELPMLHPEKFVKLGID-PPKGVLCYGPPGTGKT-LLA 219

Query: 825 RAVANGNRGFFL 860
           RAVAN     F+
Sbjct: 220 RAVANRTDACFI 231


>02_05_0986 -
           33334205-33334362,33334487-33334662,33334774-33334955,
           33335064-33335282,33335407-33335551,33336127-33336188,
           33336282-33336359,33336517-33336608,33337086-33337167,
           33337519-33337605
          Length = 426

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 651 VGYDDIGGCRKQLGAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLA 824
           V Y+D+GGC++Q+        V    +LH   F  +G+    +   C GPP   K   LA
Sbjct: 165 VTYNDVGGCKEQIEKM---REVVELPMLHPEKFVKLGID-PPKGVLCYGPPGTGKT-LLA 219

Query: 825 RAVANGNRGFFL 860
           RAVAN     F+
Sbjct: 220 RAVANRTDACFI 231


>06_01_0057 - 483710-484309
          Length = 199

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +3

Query: 87  YRPRSSVARTDPTVSLSKKQSAMTTQS-WHFHRPKWSNFNSSVVTQSCSR 233
           Y P    ART P  ++   + A    S W F    WS+  S V+T+  SR
Sbjct: 62  YFPLGPAARTSPAGTVLCFEDARGGDSTWRFRYSYWSSSQSYVITKGWSR 111


>05_07_0067 +
           27463703-27463705,27464309-27464365,27464779-27464844,
           27464985-27465096,27465281-27465409,27466076-27466191,
           27466364-27466440,27466678-27467163,27467255-27467570,
           27467618-27467797
          Length = 513

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +2

Query: 476 LTVRSIVTTPSGPRGHARRRVQSGRNRSITILHRGS 583
           + +  +V T  GP+G  +    +GR RS+T+ + G+
Sbjct: 27  MAISDLVKTTLGPKGMDKILQSTGRGRSVTVTNDGA 62


>03_05_0339 +
           23287620-23287676,23287784-23287849,23287937-23288048,
           23288240-23288368,23288795-23288866,23289245-23289360,
           23289494-23289570,23289788-23290273,23290373-23290688,
           23290769-23290915
          Length = 525

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +2

Query: 476 LTVRSIVTTPSGPRGHARRRVQSGRNRSITILHRGS 583
           + +  +V T  GP+G  +    +GR RS+T+ + G+
Sbjct: 26  MAIADLVKTTLGPKGMDKILQSTGRGRSVTVTNDGA 61


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,807,068
Number of Sequences: 37544
Number of extensions: 560700
Number of successful extensions: 1488
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1420
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1479
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2495239620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -