SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0158 - 1103461-1104186                                           50   2e-06
08_01_0202 - 1638978-1639571                                           47   2e-05
03_06_0157 - 32039020-32039175,32039267-32039338,32039478-320396...    30   2.6  
04_04_1582 - 34590698-34591199,34593849-34594690                       29   4.5  
03_01_0483 + 3689155-3689814                                           29   5.9  
03_06_0609 - 35042276-35042388,35042476-35042527,35042624-350427...    28   7.8  

>02_01_0158 - 1103461-1104186
          Length = 241

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD  ED+FVHQ++I  +      RS+ +GE VEFA+   E G  +A  VTGP G  
Sbjct: 22  FISPDDGSEDLFVHQSSIKAD----GFRSLAEGEQVEFAISESEDGRTKAVDVTGPDGSF 77

Query: 418 VKG 426
           VKG
Sbjct: 78  VKG 80



 Score = 30.7 bits (66), Expect = 1.5
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 188 AEKVSGTVKWFNVKSGYGFIN 250
           A +  GTVKWFN   G+GFI+
Sbjct: 4   AARHRGTVKWFNDTKGFGFIS 24


>08_01_0202 - 1638978-1639571
          Length = 197

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 2/75 (2%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD  ED+FVHQ+++  +      RS+ DG+ VEF+V +G  G  +A  VT PGG  
Sbjct: 21  FITPDDGGEDLFVHQSSLKSDG----YRSLNDGDVVEFSVGSGNDGRTKAVDVTAPGGGA 76

Query: 418 VK-GSPYAADKRRGY 459
           +  GS  +    RGY
Sbjct: 77  LTGGSRPSGGGDRGY 91



 Score = 33.9 bits (74), Expect = 0.16
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 188 AEKVSGTVKWFNVKSGYGFI 247
           +E+V GTVKWF+   G+GFI
Sbjct: 3   SERVKGTVKWFDATKGFGFI 22


>03_06_0157 -
           32039020-32039175,32039267-32039338,32039478-32039602,
           32039678-32040559,32040623-32040692,32041248-32041739,
           32041985-32042044,32042541-32042618,32043322-32044344
          Length = 985

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +1

Query: 337 GEAVEFAVVAGEKGFEAAGVTGPGGEPVKG 426
           GE+ E  ++ GE   E   V GPGGEP  G
Sbjct: 388 GESKEDEIIEGEPDPEMEVVAGPGGEPKVG 417


>04_04_1582 - 34590698-34591199,34593849-34594690
          Length = 447

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 331 GDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRR 453
           GDG   E +   G+KG    G  G GG   KGS  ++++ R
Sbjct: 229 GDGGVEEGSAGGGKKGGGGGGGGGGGGHGEKGSAKSSEQER 269


>03_01_0483 + 3689155-3689814
          Length = 219

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/42 (42%), Positives = 22/42 (52%)
 Frame = +1

Query: 331 GDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
           GDG A      AG  G +AA   G G +PV+GS   +D  RG
Sbjct: 62  GDGGADPVRGSAG--GSDAARGDGGGADPVRGSAGGSDAARG 101


>03_06_0609 -
           35042276-35042388,35042476-35042527,35042624-35042725,
           35043546-35043745,35045258-35045336,35045541-35045595,
           35045947-35046122,35046386-35046988,35047077-35047265,
           35048150-35048201,35048289-35048356,35048873-35048911,
           35048912-35048970,35049639-35049782,35050136-35050238,
           35050368-35050467,35050596-35050612
          Length = 716

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = -3

Query: 402 TSNTSCFKAFLPGNHGKLHRLSVADRAHSLTWVVTGDGSLMHK 274
           T N   ++ FLP   G +  L + D   ++ W ++ + SL HK
Sbjct: 293 TENDCAWQRFLPS--GPIALLPIGDNYSNIVWTMSPEESLRHK 333


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,252,168
Number of Sequences: 37544
Number of extensions: 313630
Number of successful extensions: 1167
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1164
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2268190812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -