SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_02_0140 + 12255418-12255512,12257514-12257793                       96   1e-20
08_02_1181 - 24985963-24986242,24987109-24987197                       93   1e-19
02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649     77   9e-15
08_02_0918 - 22617388-22617693,22617799-22617848,22618538-226188...    27   5.6  
09_04_0695 - 19547101-19548010,19548089-19548587,19549461-195497...    27   7.4  
01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602...    27   7.4  
04_04_0491 - 25605560-25605684,25605826-25605928,25606026-256075...    27   9.8  
03_02_0178 + 6195402-6199158,6199438-6200003                           27   9.8  

>06_02_0140 + 12255418-12255512,12257514-12257793
          Length = 124

 Score = 95.9 bits (228), Expect = 1e-20
 Identities = 44/63 (69%), Positives = 52/63 (82%)
 Frame = +2

Query: 65  KGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTR 244
           K +R G +  +EVVTREYT+NLHKRLHG  FKK+AP AIKEIRKFA+K MGT D+RVD +
Sbjct: 4   KKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTIDVRVDVK 63

Query: 245 LNK 253
           LNK
Sbjct: 64  LNK 66



 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 2/90 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  P + +   K   K  G         L + +WS G+R+VP           ND+
Sbjct: 32  CTFKKKAPNAIKEIRKFAQKAMGTIDVRVDVKLNKHIWSSGIRSVPRRVRVRIARRRNDE 91

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVD 411
           ED+  +L++LVT   VP   +KGL T+ V+
Sbjct: 92  EDAKEELYSLVTVAEVPQEGLKGLGTKLVE 121


>08_02_1181 - 24985963-24986242,24987109-24987197
          Length = 122

 Score = 92.7 bits (220), Expect = 1e-19
 Identities = 44/62 (70%), Positives = 51/62 (82%), Gaps = 1/62 (1%)
 Frame = +2

Query: 71  ERKGKSAINE-VVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRL 247
           E+KG +A  E VVTREYT+NLHKRLH   FKK+AP AIKEIRKFA+K MGT D+RVD +L
Sbjct: 3   EKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTDVRVDVKL 62

Query: 248 NK 253
           NK
Sbjct: 63  NK 64



 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  P + +   K   K  G +       L + +WS G+R+VP           ND+
Sbjct: 30  CTFKKKAPNAIKEIRKFAQKAMGTTDVRVDVKLNKHIWSSGIRSVPRRVRVRIARKRNDE 89

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVD 411
           ED+  +L++LVT   VP   +KGL T+ VD
Sbjct: 90  EDAKEELYSLVTVAEVPPEGLKGLGTKVVD 119


>02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649
          Length = 139

 Score = 76.6 bits (180), Expect = 9e-15
 Identities = 41/70 (58%), Positives = 48/70 (68%), Gaps = 16/70 (22%)
 Frame = +2

Query: 95  NEVVTREYTVNLHKRLHGV----------------GFKKRAPRAIKEIRKFAEKQMGTPD 226
           +EVVTREYT+NLHKRLHG                  FKK+AP AIKEIRKFA+K MGT D
Sbjct: 13  DEVVTREYTINLHKRLHGCIVCSNDLIHYAPDIVSTFKKKAPNAIKEIRKFAQKAMGTTD 72

Query: 227 IRVDTRLNKS 256
           IR+D +LNK+
Sbjct: 73  IRIDVKLNKA 82



 Score = 43.6 bits (98), Expect = 8e-05
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 2/86 (2%)
 Frame = +1

Query: 160 KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDDEDSA 339
           K  P + +   K   K  G +       L + +W+ G+R+VP           ND+ED+ 
Sbjct: 51  KKAPNAIKEIRKFAQKAMGTTDIRIDVKLNKAIWTNGIRSVPRRVRVRISRKRNDEEDAK 110

Query: 340 HKLFTLVTY--VPVASIKGLQTENVD 411
            +L++LVT   +P   +KGL T+ V+
Sbjct: 111 EELYSLVTVAEIPAEGLKGLGTKVVE 136


>08_02_0918 -
           22617388-22617693,22617799-22617848,22618538-22618817,
           22619654-22620340,22622870-22622944,22623150-22623285,
           22624801-22625093,22625776-22626597
          Length = 882

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -2

Query: 272 TPLDQRICLSECLLECPEFPSV 207
           T  D  I   EC ++CPEFP +
Sbjct: 755 TSSDAEIIFMECGIDCPEFPEL 776


>09_04_0695 -
           19547101-19548010,19548089-19548587,19549461-19549728,
           19551025-19551687,19551849-19552060,19552203-19552593,
           19552659-19553107,19553454-19553790
          Length = 1242

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%)
 Frame = +2

Query: 143 HGVGFKKRAPR---AIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESEMFPSVSV 298
           HG   K R P    + KE+ +  ++Q+GTP+  V      S       + P VSV
Sbjct: 218 HGAVIKARLPNYDVSAKEMAQALQQQVGTPNYDVRRCSKMSASSTNPNLLPRVSV 272


>01_06_0668 +
           31058497-31059510,31059609-31059676,31060189-31060270,
           31060339-31060431,31060516-31060668,31060900-31060968,
           31061091-31061184,31061594-31061677,31062133-31062221,
           31062340-31062456,31062567-31062707,31062823-31063005
          Length = 728

 Score = 27.1 bits (57), Expect = 7.4
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 122 VNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD 226
           +N+   ++G GF   A   + E+ K A KQ+  PD
Sbjct: 441 LNVDSAVYGAGFYASATPQLDELLKEASKQVQNPD 475


>04_04_0491 -
           25605560-25605684,25605826-25605928,25606026-25607592,
           25608694-25610198
          Length = 1099

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -2

Query: 275 LTPLDQRICLSECLLECPEFPSV 207
           L  +D RI   ECLL+ P FPS+
Sbjct: 926 LALVDLRIKNCECLLDLPSFPSL 948


>03_02_0178 + 6195402-6199158,6199438-6200003
          Length = 1440

 Score = 26.6 bits (56), Expect = 9.8
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 35  TKLKITMAKPKGERKGKSAINEVVTREYTVNL 130
           T L + M KP  E KGK    +V+++E  + +
Sbjct: 704 TALNLIMGKPSAEDKGKGIAFDVLSKEEDIGV 735


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,680,293
Number of Sequences: 37544
Number of extensions: 192082
Number of successful extensions: 418
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 408
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 418
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 931320312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -