SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0457 - 23800451-23800576,23801259-23801312,23801390-238015...    99   5e-21
12_02_0452 - 19188601-19188726,19189364-19189417,19189493-191896...    95   5e-20
02_05_0767 + 31609773-31610174,31610409-31610501,31610608-316106...    33   0.30 
06_03_0706 + 23719392-23719641,23720337-23720383,23720988-237210...    32   0.70 
02_01_0567 - 4168164-4168250,4168672-4168828,4168951-4169090,417...    32   0.70 
02_05_0661 - 30693701-30693853,30694037-30694196,30694290-306943...    31   1.2  
12_01_0090 + 717524-719080                                             30   2.1  
03_06_0069 - 31449319-31450368                                         30   2.1  
01_05_0635 - 23847255-23847287,23847397-23848083,23848178-238485...    29   3.7  
03_05_0929 - 28898627-28898728,28898826-28898906,28899419-288995...    29   4.9  
04_04_0702 + 27383876-27384862                                         29   6.5  
05_03_0459 - 14284513-14286336                                         28   8.6  
02_02_0109 + 6830802-6833412,6833491-6833861                           28   8.6  

>11_06_0457 -
           23800451-23800576,23801259-23801312,23801390-23801539,
           23801919-23802012,23802460-23802567,23802661-23802793,
           23802903-23803139,23803488-23803586,23804968-23804983
          Length = 338

 Score = 98.7 bits (235), Expect = 5e-21
 Identities = 50/94 (53%), Positives = 64/94 (68%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           L+K+L      V+LVSGGFR +I+PVA  L IP  NI AN+L F  +GEYAGFD  EPTS
Sbjct: 206 LIKKLKANNTDVFLVSGGFRQMIKPVASELGIPPENIIANQLLFGTSGEYAGFDPTEPTS 265

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           RSGG  L V+++ + HGY+ LV++ G G    EA
Sbjct: 266 RSGGKALAVQQIRQNHGYKTLVMI-GDGATDLEA 298



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 45/83 (54%), Positives = 57/83 (68%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           E +  AD VCFDVDSTV  DEGIDELA FCG G  V   TA+AM G + F+EAL  RL +
Sbjct: 121 ETWCNADAVCFDVDSTVCLDEGIDELADFCGAGKAVAEWTAKAMTGTVPFEEALAARLSL 180

Query: 436 IRPNVGQIREFIEKFPVRLTPGI 504
           I+P + Q+ + + K P R++PGI
Sbjct: 181 IKPYLSQVDDCLVKRPPRISPGI 203


>12_02_0452 -
           19188601-19188726,19189364-19189417,19189493-19189642,
           19189994-19190087,19190607-19190710
          Length = 175

 Score = 95.5 bits (227), Expect = 5e-20
 Identities = 51/94 (54%), Positives = 64/94 (68%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LVK L  + V VYLVSGGFR +I+PVA +L IP  NIFAN+L F  +GEY GFD +EPTS
Sbjct: 43  LVKMLKAKNVDVYLVSGGFRQMIKPVAMQLGIPPENIFANQLLFGTSGEYVGFDPSEPTS 102

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           RSGG  + V+ + +  GY+ L +V G G    EA
Sbjct: 103 RSGGKAVAVQNIRQKCGYRTLFMV-GDGATDLEA 135



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/40 (42%), Positives = 30/40 (75%)
 Frame = +1

Query: 385 MGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           M G++ F++AL  RL + +P++GQ+ + +EK P R++PGI
Sbjct: 1   MTGSVPFEKALAARLSLFKPSLGQVEDCMEKRPPRISPGI 40


>02_05_0767 +
           31609773-31610174,31610409-31610501,31610608-31610668,
           31610797-31610865,31611274-31611440
          Length = 263

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PPI+S++SL+ S+P P      + P   +TV + S  + S+  ++S  S   ++  S PV
Sbjct: 4   PPISSSLSLMASNPIPS--PPVAKPGRPLTVAACSNSSSSS-SSSSPSSTSCSAAWSLPV 60

Query: 212 RASSTSR 192
             S+  R
Sbjct: 61  ATSAGRR 67


>06_03_0706 +
           23719392-23719641,23720337-23720383,23720988-23721060,
           23721323-23721540,23721868-23722170,23722322-23722399,
           23723064-23723549,23723875-23724312
          Length = 630

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 401 VILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSA-VLNNS 255
           V+ PP +S  + + SSP  +N  + SMPSS  T ES S  T +A VL+ S
Sbjct: 486 VLAPPSSS--NAVESSPKIENSGTKSMPSSQHTSESDSATTSAAQVLDKS 533


>02_01_0567 -
           4168164-4168250,4168672-4168828,4168951-4169090,
           4170318-4170456,4170562-4170830,4170914-4171000,
           4171259-4171327,4171427-4171455,4171544-4171950,
           4172906-4172977,4173150-4173221,4173299-4173370,
           4173454-4173519,4173717-4173785,4173866-4173995,
           4174846-4174975
          Length = 664

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 33/95 (34%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = -2

Query: 434 MSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNS 255
           +SS  F  S    L  ++S  +L   +PF  ++A S+ PSS  T  ST  QT S     S
Sbjct: 182 ISSNNFSGSLPPSLGSLSSLTTLKDGNPFNTSIAPSASPSSTPT-GSTPTQTPS-----S 235

Query: 254 GQSVGATSR*STPVRAS--STSRTAGCFSNCKEPS 156
             S G  S  S+P  +S  ST+R +   S+ K  S
Sbjct: 236 PSSSGTPSPSSSPSNSSGGSTARDSSSPSSRKHKS 270


>02_05_0661 -
           30693701-30693853,30694037-30694196,30694290-30694381,
           30694469-30694543,30694671-30694799,30694916-30695003,
           30695118-30695224,30695645-30695693,30695802-30695905,
           30696108-30696147,30696838-30696911
          Length = 356

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 20/67 (29%), Positives = 30/67 (44%)
 Frame = +2

Query: 410 KP*RRDWTSSGLTSVRSENSLRNFQLD*LLVLQVSERVTRKRSHRISSFGRIQESNRTGR 589
           KP   DW  +G  +  S  S+RN      ++    E++  +    IS++G   E   TGR
Sbjct: 237 KPIPGDWNGAGAHTNYSTKSMRN-DGGYEIIKSAIEKLKLRHKEHISAYGEGNERRLTGR 295

Query: 590 GETKHPN 610
            ET   N
Sbjct: 296 HETADIN 302


>12_01_0090 + 717524-719080
          Length = 518

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 28/79 (35%), Positives = 41/79 (51%)
 Frame = -2

Query: 500 PGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSM 321
           P  S  G   +++L+   LGL+  S F  A  +  LPP  SA+SLL  +P P  L S S+
Sbjct: 13  PRRSAAGGHQLHALL-AKLGLLHRSEFLSALLSR-LPPSPSALSLLLEAP-PAVL-SPSL 68

Query: 320 PSSCMTVESTSKQTQSAVL 264
               +   S+S+   SA+L
Sbjct: 69  VCPVIVAFSSSQAPSSALL 87


>03_06_0069 - 31449319-31450368
          Length = 349

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = -2

Query: 365 LTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA--SSTSR 192
           + S+P P    SSS  SS  + ++T +++ SA  +  GQ  G  +    P+R    ++S 
Sbjct: 22  IVSNPSP---TSSSSTSSRSSAQATQQRSSSATSSPHGQGQGGGAAEQAPLRCPRCNSSN 78

Query: 191 TAGCFSN 171
           T  C+ N
Sbjct: 79  TKFCYYN 85


>01_05_0635 -
           23847255-23847287,23847397-23848083,23848178-23848540,
           23848633-23848725,23848820-23848870,23849031-23849304,
           23849766-23850595
          Length = 776

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -1

Query: 825 PKPMKPSAGGXKPRASVAPVPGRSPGAG 742
           P   + SA G +P +S AP P  +PG G
Sbjct: 2   PVSTRASAAGGQPWSSAAPAPASAPGRG 29


>03_05_0929 -
           28898627-28898728,28898826-28898906,28899419-28899523,
           28899598-28899670,28900235-28900287,28900987-28901307
          Length = 244

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +1

Query: 211 LTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGID 327
           +TGV   +VAP      F    C CF+ + T++  E ID
Sbjct: 172 ITGVSTYNVAPMKAAIYFNKIQCFCFE-EQTLLPGEQID 209


>04_04_0702 + 27383876-27384862
          Length = 328

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 20/70 (28%), Positives = 32/70 (45%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP  SA +  T+    Q           + V S + +T++   N+S  S   TSR +TP 
Sbjct: 213 PPAHSAAASTTNKRKRQPSEDPDDGVEVIGVVSKAVKTEAPTSNSSSLSSSLTSRDTTPA 272

Query: 212 RASSTSRTAG 183
            +S+ +  AG
Sbjct: 273 TSSAGAEHAG 282


>05_03_0459 - 14284513-14286336
          Length = 607

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 21/76 (27%), Positives = 36/76 (47%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           I   VS ++ + FP +  SSS  S   +  S+S  + S+  ++SG S G++S   +   +
Sbjct: 250 IYGGVSPVSVNNFPDSPRSSSSRSDSSSSSSSSNGSGSSSSSSSGASSGSSSCAGSSSSS 309

Query: 206 SSTSRTAGCFSNCKEP 159
           S +   A   S    P
Sbjct: 310 SGSDTDADADSASNRP 325


>02_02_0109 + 6830802-6833412,6833491-6833861
          Length = 993

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 525 HERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRL 635
           H++   +YL + GF   IEP    LN+  I++ +N L
Sbjct: 266 HKKLQNLYLYANGFTGEIEPNVSALNLVEIDVSSNEL 302


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,868,376
Number of Sequences: 37544
Number of extensions: 479796
Number of successful extensions: 1603
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1508
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1601
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2495239620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -