SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0423 + 3337401-3337419,3337777-3338235,3338650-3338735,333...    28   8.8  
06_03_1476 - 30399317-30399347,30399636-30399722,30400035-304001...    28   8.8  

>12_01_0423 +
           3337401-3337419,3337777-3338235,3338650-3338735,
           3338974-3339022,3339225-3339533,3339555-3339710,
           3339871-3340086,3340404-3340906,3341050-3341116,
           3341215-3341272,3341561-3341699,3341840-3341956,
           3342069-3342246,3342459-3343093
          Length = 996

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +1

Query: 94  GMKLNGMG*DGRTMYVIPFSMGPVGSPLSKIGVEITDSPY 213
           G +  G G    T    PF+  P GSP++  G +  +SP+
Sbjct: 25  GAQTGGFG-QANTTTTNPFAPKPFGSPITAFGAQTGNSPF 63


>06_03_1476 -
           30399317-30399347,30399636-30399722,30400035-30400192,
           30400276-30400497,30400744-30400881,30400977-30401105,
           30401346-30401369,30401569-30401614,30401692-30401773,
           30401836-30401955,30402039-30402072
          Length = 356

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -2

Query: 513 LCRR*AYVRPAILRDERSLIPDVERSTSCPTNYC 412
           +C R AY R  IL  ER ++  ++   S PT YC
Sbjct: 252 ICDR-AYTRTDILEMERMIVNTLQFDMSVPTPYC 284


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,782,763
Number of Sequences: 37544
Number of extensions: 498302
Number of successful extensions: 1179
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1179
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2553813320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -