SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1311 - 26039741-26039930,26040185-26040316,26040528-260406...    39   0.004
06_03_0025 - 15577231-15577420,15577682-15577813,15578025-155781...    33   0.27 
08_02_0824 + 21561699-21562415,21563294-21563362,21563424-215634...    29   4.4  
04_03_0922 + 20834195-20836603                                         28   7.7  

>08_02_1311 -
           26039741-26039930,26040185-26040316,26040528-26040676,
           26040807-26040893,26041338-26041420,26042008-26042137
          Length = 256

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 8/120 (6%)
 Frame = +3

Query: 285 SQYXQTFTSMKENIEXXITSN--------KTLKIVDLPGXERLRNKFFXQHXSSAKGIVF 440
           S +  T TSM++N +  +  +        K + +VD+PG  RL+ K   +    A GIV+
Sbjct: 76  STHQGTVTSMEQNNDTFVLHSELERRGKVKPVHVVDVPGHARLKPKL-DEVLPQAAGIVY 134

Query: 441 VIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
           V+ + +    +   A YLY IL   +    ++P     NK  +      +  K   EKEL
Sbjct: 135 VVDAQDFLSTMHAAAEYLYDILTKATVVKKRVPVLIFCNKTDKVTAHSKEFIKKQLEKEL 194


>06_03_0025 -
           15577231-15577420,15577682-15577813,15578025-15578173,
           15579012-15579071,15593208-15593297,15593604-15593871,
           15594517-15594608,15595355-15595441,15597333-15597440,
           15597709-15597822,15598253-15598420,15599442-15599579,
           15599699-15599908,15600986-15601237,15601965-15602111,
           15603327-15603443
          Length = 773

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTIL 506
           K + +VD+PG   L+ K   +    A GIVF + + +    +  VA YLY IL
Sbjct: 622 KPVHVVDVPGHAGLKPKL-DEVLPQAAGIVFAVDAQDFLSTMQVVAEYLYDIL 673


>08_02_0824 +
           21561699-21562415,21563294-21563362,21563424-21563459,
           21564533-21564600,21565259-21565277,21565662-21565763,
           21566173-21566288,21566501-21566595,21568093-21568264,
           21568413-21568493,21569732-21569801,21570106-21570132
          Length = 523

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 197 SLEGILFATQYC*WAYQTLE 256
           SL GIL  TQYC W  + LE
Sbjct: 374 SLSGILLQTQYCGWGSRALE 393


>04_03_0922 + 20834195-20836603
          Length = 802

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = +1

Query: 142 ITLLSLIVLAVTLIFWWIFSRRY 210
           ++  +L +LA+ L+ WW  S+RY
Sbjct: 456 LSFAALFMLAIALVIWWNKSKRY 478


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,890,764
Number of Sequences: 37544
Number of extensions: 311810
Number of successful extensions: 676
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 668
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 675
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2221181676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -