SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0300 + 2427524-2427827,2429066-2429274,2429512-2430150           36   0.055
08_02_1234 + 25437340-25437502,25437983-25438381,25441198-254416...    33   0.29 
02_03_0212 - 16460665-16460766,16460971-16461298,16461379-164615...    29   4.8  
11_04_0158 + 14207463-14207629,14207724-14207774,14207874-142080...    29   6.3  
04_01_0532 - 6938763-6941177                                           29   6.3  
10_08_0829 - 20871810-20872011,20873226-20873359,20873480-208773...    28   8.4  
01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491,117...    28   8.4  

>08_01_0300 + 2427524-2427827,2429066-2429274,2429512-2430150
          Length = 383

 Score = 35.5 bits (78), Expect = 0.055
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +2

Query: 287 PKTFHPSSVPLPIRQGYVPKGQAPPGK-KANAELMKIPNFLHLTPPV 424
           P  + P+ VP+P   GYVP   APPG  +A  E++K P  +H  PPV
Sbjct: 280 PPYYPPAFVPMPY-YGYVPVFYAPPGAVQAQHEVVK-PVAVHSKPPV 324


>08_02_1234 +
           25437340-25437502,25437983-25438381,25441198-25441615,
           25442353-25442542
          Length = 389

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +1

Query: 562 NPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           +P  R V L V + +L L +HA  + + +VG+RY+   D +TI S
Sbjct: 281 HPKNRKVKLSVTVKELGLSRHAFRRLREVVGNRYNSGKDELTITS 325


>02_03_0212 -
           16460665-16460766,16460971-16461298,16461379-16461502,
           16461576-16461825,16462185-16462265,16463030-16463114,
           16463200-16463321,16463865-16464672,16464775-16465027,
           16465998-16466796
          Length = 983

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = +1

Query: 262 ELGECVAWSENFPPVFGAITDTSGLRTKGS 351
           E GEC+AW  +  PVF   T   G    GS
Sbjct: 244 EAGECIAWEAHRGPVFALTTSLYGDLWSGS 273


>11_04_0158 +
           14207463-14207629,14207724-14207774,14207874-14208002,
           14209342-14209447,14209491-14209601,14210042-14210098,
           14210903-14211727
          Length = 481

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLP 322
           PGP  FHPSS P+P
Sbjct: 283 PGPAAFHPSSRPMP 296


>04_01_0532 - 6938763-6941177
          Length = 804

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 20/78 (25%), Positives = 31/78 (39%)
 Frame = +3

Query: 114 TSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRIDRMAQTRTGGMCGLVRK 293
           T A   + KG+ ++E      +KK DK+Q    K   V+   I R        M G   +
Sbjct: 522 TGASGIVYKGQLQDELGTYIAVKKIDKIQHETEKEFAVEVQTIGRTYHKNLVRMLGFCNE 581

Query: 294 LSTRLRCHYRYVRATYQR 347
            + RL  +   V  +  R
Sbjct: 582 GTERLLVYEFMVNGSLNR 599


>10_08_0829 -
           20871810-20872011,20873226-20873359,20873480-20877313,
           20878057-20878177,20878414-20878451,20879096-20879218,
           20879308-20879505,20880270-20880356
          Length = 1578

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/55 (23%), Positives = 31/55 (56%)
 Frame = +3

Query: 33  KMSILIKRSKSGCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDKM 197
           +++  +K  ++ C +    +  +R  S+  +  L+K +EE + R+L++   RDK+
Sbjct: 590 RLTSKVKYLETKCADLELKLISFRSESSELEEKLQKSQEELKDRILELSDLRDKL 644


>01_01_0128 -
           1167904-1168749,1168790-1168863,1169419-1169491,
           1171148-1171398,1171442-1171687,1172220-1172415,
           1172796-1172876,1172966-1173169,1173671-1173880,
           1173953-1174174,1174437-1174480,1174974-1175052,
           1175066-1175227,1175337-1175564,1175786-1175815,
           1175905-1176273,1176356-1176571,1177202-1177683,
           1177930-1177975
          Length = 1352

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/41 (29%), Positives = 30/41 (73%), Gaps = 2/41 (4%)
 Frame = +3

Query: 126 SALKKGEEEEEFRVL-DI-LKKRDKMQRRVVKRTDVQPDRI 242
           S LKK  E+E  R+L D+ L+++++++R++V++  ++ + +
Sbjct: 636 SVLKKSAEDERIRLLNDVKLREQERIRRQLVEKEKIEAEEL 676


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,097,664
Number of Sequences: 37544
Number of extensions: 500281
Number of successful extensions: 1216
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1216
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2420970504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -