SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1121 + 24457413-24457528,24458395-24458552,24458927-244590...    35   0.074
08_01_0027 - 195321-195932,197206-197415                               35   0.098
08_02_1308 - 26024491-26025405                                         33   0.23 
08_02_1309 - 26029691-26030609,26030850-26030925,26032198-26032579     32   0.52 
08_02_1251 - 25592537-25593380,25593589-25593893                       31   0.92 
05_04_0228 - 19224901-19224991,19225095-19225219,19225293-192254...    31   1.6  
08_01_0657 + 5674907-5674993,5675615-5676583                           30   2.8  
02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182...    30   2.8  
01_01_1137 + 9017211-9018584                                           30   2.8  
12_01_0579 + 4741403-4742083                                           29   3.7  
04_03_0584 + 17546945-17547382                                         29   3.7  
12_01_0421 - 3321590-3323692                                           29   6.5  
02_05_0395 - 28596957-28597400,28598506-28598586,28600049-28600270     29   6.5  
02_04_0543 + 23766089-23766328,23766976-23767212,23767601-23767876     29   6.5  
11_06_0463 + 23879587-23879771,23879783-23881658                       28   8.5  
11_06_0416 + 23307984-23308281,23310083-23310900                       28   8.5  
08_02_1304 - 26008105-26009070                                         28   8.5  
07_03_1529 + 27491963-27492465,27493045-27493154,27493384-274935...    28   8.5  
02_02_0609 + 12105616-12106336,12106514-12106646,12107849-121080...    28   8.5  

>08_02_1121 +
           24457413-24457528,24458395-24458552,24458927-24459042,
           24459735-24460400
          Length = 351

 Score = 35.1 bits (77), Expect = 0.074
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLIS 392
           D  + A DG S   HRAIL++ SP F ++F+  L  +E S V IS
Sbjct: 187 DITINATDG-SIMAHRAILASRSPVFRSMFSHDLKEKELSTVDIS 230


>08_01_0027 - 195321-195932,197206-197415
          Length = 273

 Score = 34.7 bits (76), Expect = 0.098
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLIS 392
           D  +   DG     H+AIL++CSP F ++F   L  +E S + I+
Sbjct: 109 DVTINTTDGV-LKAHKAILASCSPVFESMFLHDLKEKESSTININ 152


>08_02_1308 - 26024491-26025405
          Length = 304

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           DG +FP HRA+L+A SP F A    ++   + S + +  +
Sbjct: 135 DGETFPAHRAVLAARSPVFRAELLGSMAESKMSSITLHDI 174


>08_02_1309 - 26029691-26030609,26030850-26030925,26032198-26032579
          Length = 458

 Score = 32.3 bits (70), Expect = 0.52
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           DG +FP HRA+L+A SP F A    ++   + S + +  +
Sbjct: 281 DGETFPAHRAVLAARSPVFRAELLGSMAEAKMSCITLHDI 320


>08_02_1251 - 25592537-25593380,25593589-25593893
          Length = 382

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVR 401
           G +F  HRA+L+ CSP F AL  ++        + ++ ++
Sbjct: 232 GETFHAHRALLAVCSPVFKALLLSSTAEAAACSITLNDIK 271


>05_04_0228 -
           19224901-19224991,19225095-19225219,19225293-19225410,
           19225554-19225618,19225760-19225839,19225942-19226005,
           19227341-19227480,19227571-19227694,19227781-19227840,
           19227922-19227990,19228139-19228288,19229182-19229289,
           19229573-19229648,19229960-19230054,19231729-19231803,
           19231923-19232043,19232136-19232308,19232647-19232813,
           19232944-19233301
          Length = 752

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 21/83 (25%), Positives = 31/83 (37%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           SS    +    +G  F  HR  L A S  F A+F      ++  D+ I  +R        
Sbjct: 582 SSTLSDVTFLVEGKRFYAHRIALLASSDAFRAMFDGGYREKDARDIEIPNIRWNVFELMM 641

Query: 426 XXXXXXXIDVTDTNVHELLMTAD 494
                  ++VT     +LL  AD
Sbjct: 642 RFIYTGSVEVTSDISQDLLRAAD 664


>08_01_0657 + 5674907-5674993,5675615-5676583
          Length = 351

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           G  FP HRAIL++ SP F+A     +  +    V I  +
Sbjct: 193 GKCFPAHRAILASRSPVFMASLFGDMKEKSSRSVEIRDI 231


>02_04_0289 +
           21615745-21616155,21617417-21617870,21618162-21618217,
           21618307-21618437,21618565-21618727
          Length = 404

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +3

Query: 147 NGKRPK*QSDGGSGNRSVHVGGSDAGA 227
           +G  P  QSD  S NR+++VGG D  A
Sbjct: 291 SGSSPPRQSDSDSTNRTIYVGGLDPNA 317


>01_01_1137 + 9017211-9018584
          Length = 457

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +3

Query: 198 VHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAI 311
           VH   SD+G PS++R     DA++ A DGA+  V R +
Sbjct: 163 VHYISSDSGGPSSSRCVLEVDAVIGA-DGANSRVAREV 199


>12_01_0579 + 4741403-4742083
          Length = 226

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 325 LQAESIARCTGKEAPSSARTIASQADDTRAVD 230
           LQAE+  R T +E PS+A  + ++ DD  + D
Sbjct: 129 LQAETRRRATPEEEPSTAAVVVTEEDDEESDD 160


>04_03_0584 + 17546945-17547382
          Length = 145

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = +3

Query: 135 NAQRNGKRPK*QSDGGSGNRSVHVGGSDAGAPSTARVSSACD----AIVRADDGASFP 296
           NA+R G R   ++  G G R    GG  A  P  + V+ A      A    DDG + P
Sbjct: 34  NARRRGLRTNQRAGRGGGRRGDAEGGDGAAGPHLSGVAGAAGGSTVAATPLDDGGNAP 91


>12_01_0421 - 3321590-3323692
          Length = 700

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +3

Query: 177 GGSGNRSVHVGGSDAGAPSTARVSSACDAIVRA-DDG 284
           GG G      GG D G P  A +S   DA V A  DG
Sbjct: 92  GGDGGGGGDGGGGDGGVPDLAALSVEIDAFVAAGQDG 128


>02_05_0395 - 28596957-28597400,28598506-28598586,28600049-28600270
          Length = 248

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 4/74 (5%)
 Frame = -1

Query: 340 ARKYGLQAESIARCTGKEAPSSARTIASQADDT----RAVDGAPASLPPTCTDRFPDPPS 173
           AR     A   A  +G     SAR I   +D T    RA   A A + P      P PP+
Sbjct: 2   ARHSAFFASRAACPSGSAGEFSARRICLYSDSTTGRLRARSSAVAQIIPPPAFAIPPPPT 61

Query: 172 DCYLGRFPFLCAFR 131
              LGR    CA +
Sbjct: 62  QWPLGREAEACALQ 75


>02_04_0543 + 23766089-23766328,23766976-23767212,23767601-23767876
          Length = 250

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +3

Query: 171 SDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVR 272
           S GG GNR+   G  D+G P       + D +V+
Sbjct: 115 SGGGGGNRNRRGGSGDSGGPEDESFKESLDELVQ 148


>11_06_0463 + 23879587-23879771,23879783-23881658
          Length = 686

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 243 VSSACDAIVRAD-DGASFPVHRAILSACSPYFLALFTTTLHSR 368
           ++S   A VR + DG +F  HR IL+A SP F A    ++  R
Sbjct: 507 LASEAAADVRFNVDGEAFAAHRCILAARSPVFRAELFGSMRER 549


>11_06_0416 + 23307984-23308281,23310083-23310900
          Length = 371

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLA-LFTTTLHSREQSDVLI 389
           G +F  HR +L+A SP F+A LF     SR  ++  I
Sbjct: 209 GETFAAHRCVLAARSPVFMAELFGPMAMSRHNNEETI 245


>08_02_1304 - 26008105-26009070
          Length = 321

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +3

Query: 210 GSDAGAPSTARVSSACDAIV-RADDGASFPVHRAILSACSPYFLA 341
           G D  A   + + S   A+V  A  G +F  HRA+L+A SP F A
Sbjct: 137 GDDHVAVPPSNLGSQLAAMVGSAVGGETFHAHRAVLAARSPVFRA 181


>07_03_1529 +
           27491963-27492465,27493045-27493154,27493384-27493510,
           27494082-27494430,27494975-27495251,27496236-27496333,
           27498090-27498214,27498270-27498326,27498328-27498370,
           27498581-27498667,27498802-27498882,27499735-27499901,
           27499987-27500098,27500188-27500390,27500473-27500607,
           27501106-27501205
          Length = 857

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRS 404
           DG  FP H+ +L+A SP F A     +  +    + I  + +
Sbjct: 318 DGEVFPAHKVVLAARSPVFRAQLFGPMKDKNMKRITIEDMEA 359


>02_02_0609 +
           12105616-12106336,12106514-12106646,12107849-12108048,
           12108184-12108635,12109018-12109323
          Length = 603

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 156 RPK*QSDGGSGNRSVHVGGSDAGAPSTARVSS 251
           R K ++DG SG+   +VGGS  G   T   SS
Sbjct: 555 RRKRENDGSSGSNRKNVGGSSGGKKKTVGGSS 586


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,190,676
Number of Sequences: 37544
Number of extensions: 506289
Number of successful extensions: 1696
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1616
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1694
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2467979640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -