SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0220 - 1657554-1657620,1657943-1658109,1658110-1658267,165...    30   2.8  
11_01_0219 - 1710206-1710246,1710479-1710620,1710699-1710752,171...    30   2.8  
10_06_0080 + 10441055-10443856                                         28   8.4  

>12_01_0220 -
           1657554-1657620,1657943-1658109,1658110-1658267,
           1658362-1658447,1658559-1658808,1659194-1660320,
           1662207-1662351,1663555-1663696,1663775-1663828,
           1663914-1663985,1664710-1664778,1664885-1664926,
           1665024-1665092,1665257-1665394,1665518-1665628,
           1665704-1665836,1666834-1666889,1667191-1667901
          Length = 1198

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 254 LVPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKP 364
           LVP  +P  PPP+S    GP +D  Q+     LL +P
Sbjct: 51  LVPF-SPAQPPPLSNLLAGPAFDAEQIWSQIELLSRP 86


>11_01_0219 -
           1710206-1710246,1710479-1710620,1710699-1710752,
           1710838-1710909,1711631-1711699,1711807-1711848,
           1711946-1712014,1712130-1712267,1712390-1712500,
           1712576-1712726,1713720-1713775,1714076-1714753
          Length = 540

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 254 LVPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKP 364
           LVP  +P  PPP+S    GP +D  Q+     LL +P
Sbjct: 51  LVPF-SPAQPPPLSNLLAGPAFDAEQIWSQIELLSRP 86


>10_06_0080 + 10441055-10443856
          Length = 933

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 14/53 (26%), Positives = 31/53 (58%)
 Frame = -3

Query: 526 IAKLCDVAGVLWVVSQELNIVHGLVQDTFISENVINNRINETHFLFVLEIDLL 368
           + +L ++ G +  + +EL ++H      F+S   + NR N+T+ ++V E+ +L
Sbjct: 33  VTQLTELQGSMGRIKRELRLMH-----EFLSRMDVRNRNNQTYEIWVEEVRML 80


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,334,767
Number of Sequences: 37544
Number of extensions: 465853
Number of successful extensions: 1156
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1156
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2432722788
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -