SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1175 + 28168007-28170058                                         30   1.9  
12_01_1031 - 10605581-10606088,10606360-10606420,10606448-106064...    29   5.8  
06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,805...    28   7.7  
02_02_0298 - 8713660-8714073                                           28   7.7  

>06_03_1175 + 28168007-28170058
          Length = 683

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%)
 Frame = -2

Query: 622 RCCLRFSCYFGSS---CHSGACVCRGCSGYG 539
           +CC+ FS Y+  S   C++ AC C G  G G
Sbjct: 431 KCCVSFSAYYDDSVVPCNTCACGCGGGGGGG 461


>12_01_1031 - 10605581-10606088,10606360-10606420,10606448-10606491,
            10606664-10608382,10609848-10610791
          Length = 1091

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +3

Query: 258  IFSKRNIDPEQIKEINNYYDIETTVTVEF 344
            +F K N+D ++++ + ++YDIE  V   F
Sbjct: 1029 VFIKVNVDSDELESVTDWYDIEGIVPTFF 1057


>06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,
            8057595-8058314,8058404-8058603,8058988-8059172,
            8059287-8059354,8059432-8060246,8060502-8060599,
            8060702-8060887,8061358-8061538,8061651-8061812,
            8061894-8061937,8062059-8062115,8062409-8062505,
            8062614-8062786,8062868-8063081,8063270-8063395,
            8064072-8064188,8064459-8064566,8064729-8064898,
            8065049-8065127,8065211-8065285,8065845-8065942,
            8066030-8066137,8066238-8066295,8066527-8066631,
            8067461-8069516,8069804-8070697,8070896-8071852,
            8072022-8072075,8072157-8072222,8072294-8073472,
            8073868-8075598,8075764-8075829,8076763-8077788,
            8077893-8078041
          Length = 4264

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +2

Query: 665  QRRKEIPASKGSSQPSKAGHNL*SRLPFFLKPXTTHSNSGKQ 790
            Q +KE  +S G S P+K       R    L P T   N+GKQ
Sbjct: 1593 QAKKEPASSVGDSPPAKRRRGRPRRSDASLSPVTAPPNTGKQ 1634


>02_02_0298 - 8713660-8714073
          Length = 137

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 383 LLQKQNRRSNNGKLQTDPFSGDHCAEC 463
           +LQ+  R+ N G L T   +GD CA C
Sbjct: 77  VLQEMARKRNRGLLTTAAAAGDACAAC 103


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,117,960
Number of Sequences: 37544
Number of extensions: 357655
Number of successful extensions: 923
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 897
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 923
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2221181676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -