SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0548 + 4099386-4099847,4100435-4101316                          202   4e-52
03_01_0547 + 4093196-4093657,4094267-4095148                          202   4e-52
03_01_0544 + 4082528-4082989,4083585-4084466                          202   4e-52
03_01_0543 + 4076981-4077442,4078145-4079026                          202   4e-52
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...   126   2e-29
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...   114   8e-26
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...   113   1e-25
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...   113   1e-25
04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...   113   2e-25
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    69   7e-12
02_04_0462 + 23131433-23132836                                         69   7e-12
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    36   0.043
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    35   0.075
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    32   0.53 
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    32   0.53 
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    32   0.53 
03_05_0511 + 25056018-25059107                                         32   0.70 
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    31   0.92 
02_04_0148 - 20198407-20201424                                         31   0.92 
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    31   0.92 
04_01_0103 + 1082077-1082167,1083037-1085477                           31   1.2  
02_04_0017 + 18937774-18937864,18938505-18940945                       31   1.2  
05_05_0202 - 23211342-23211385,23211493-23211579,23211666-232117...    31   1.6  
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    31   1.6  
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     31   1.6  
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    30   2.1  
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    30   2.8  
01_06_0662 + 30987187-30987277,30987825-30990214                       30   2.8  
09_06_0237 + 21788886-21789965                                         29   3.7  
07_03_1637 + 28293033-28293779,28294652-28295233,28295650-282958...    29   3.7  
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    29   3.7  
01_01_0016 - 88825-90411                                               29   4.9  
08_01_0560 - 4954479-4954746,4955106-4955167,4955208-4955284,495...    29   6.5  
07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950     29   6.5  
10_08_0035 - 14321699-14321751,14321800-14321914,14322136-143221...    28   8.6  

>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score =  202 bits (492), Expect = 4e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score =  202 bits (492), Expect = 4e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score =  202 bits (492), Expect = 4e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score =  202 bits (492), Expect = 4e-52
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/68 (91%), Positives = 63/68 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score =  126 bits (305), Expect = 2e-29
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN--GQTREHA 450
           F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  N  GQT+EH+
Sbjct: 307 FDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGINGIGQTKEHS 366

Query: 451 LLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWH 630
            L  + GV  LIV VNKMDS+ +     +  KS  +     R  GY  +AVA+VPIS   
Sbjct: 367 QLVRSFGVDNLIVVVNKMDSVEYSKERFNFIKS--QLGAFLRSCGYKDSAVAWVPISAME 424

Query: 631 GDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNS 807
            +N++  ++       W         DG CL++A+D + PP+R ++ P   P   + +S
Sbjct: 425 NENLMTTASDTR-LSSWY--------DGNCLLKAIDTLPPPSRDVSKPLRLPICDVFSS 474



 Score = 31.5 bits (68), Expect = 0.92
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +3

Query: 186 MGKGSFKYAWVLDKLKAERE 245
           +GKGSF YAW +D+   ERE
Sbjct: 276 IGKGSFAYAWAMDESADERE 295


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score =  114 bits (275), Expect = 8e-26
 Identities = 71/178 (39%), Positives = 89/178 (50%), Gaps = 1/178 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQ
Sbjct: 19  VEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQ 78

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAAVAFV 612
           TREH LLA TLGV +L+V +NKMD            +   K     +  GYN    V F+
Sbjct: 79  TREHVLLAKTLGVSKLVVVINKMDESTVGWSKERYDEIEGKMVPFLKSSGYNVKKDVHFL 138

Query: 613 PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           PISG  G NM     K      W          G CL E LD I  P R    P   P
Sbjct: 139 PISGLLGTNMKTRMDKSN-CSWW---------SGPCLFEVLDCIQVPLRDPKGPVRMP 186


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score =  113 bits (273), Expect = 1e-25
 Identities = 63/180 (35%), Positives = 104/180 (57%), Gaps = 5/180 (2%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN---- 429
           +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+       
Sbjct: 315 VAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGMDGEGGKS 374

Query: 430 -GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVA 606
            GQT+EHA L  + GV+QLIV VNKMD++ +     +  K   +     R   +  ++V 
Sbjct: 375 VGQTKEHAQLIRSFGVEQLIVAVNKMDAIGYSKERFEFIKV--QLGSFLRSCNFKDSSVT 432

Query: 607 FVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           ++P+S     N+++  + +     +Q         G CL++A+D++  P+R ++ P + P
Sbjct: 433 WIPLSAVENQNLIKIPSDVRLTSWYQ---------GFCLLDAIDSLQLPSRDVSKPLILP 483



 Score = 79.0 bits (186), Expect = 5e-15
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 237 ERE 245
           ERE
Sbjct: 306 ERE 308


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score =  113 bits (273), Expect = 1e-25
 Identities = 63/180 (35%), Positives = 104/180 (57%), Gaps = 5/180 (2%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN---- 429
           +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+       
Sbjct: 315 VAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGMDGEGGKS 374

Query: 430 -GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVA 606
            GQT+EHA L  + GV+QLIV VNKMD++ +     +  K   +     R   +  ++V 
Sbjct: 375 VGQTKEHAQLIRSFGVEQLIVAVNKMDAIGYSKERFEFIKV--QLGSFLRSCNFKDSSVT 432

Query: 607 FVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           ++P+S     N+++  + +     +Q         G CL++A+D++  P+R ++ P + P
Sbjct: 433 WIPLSAVENQNLIKIPSDVRLTSWYQ---------GFCLLDAIDSLQLPSRDVSKPLILP 483



 Score = 79.0 bits (186), Expect = 5e-15
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 237 ERE 245
           ERE
Sbjct: 306 ERE 308


>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score =  113 bits (272), Expect = 2e-25
 Identities = 75/182 (41%), Positives = 90/182 (49%), Gaps = 5/182 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAP----GHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 423
           +++    FET     TI+DAP    GH+ ++ NMI+G SQAD  VL+++A  GEFE G  
Sbjct: 60  VEVGRAHFETETTRFTILDAPVKMKGHKSYVPNMISGASQADIGVLVISARKGEFETGYE 119

Query: 424 KNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAA 600
           K GQTREH LLA TLGV +LIV +NKMD            +   K     R  GYN    
Sbjct: 120 KGGQTREHVLLAKTLGVAKLIVVINKMDEPTVKWSKERYDEIESKMVPFLRSSGYNVKKD 179

Query: 601 VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCV 780
           V F+PISG  G NM     K      W         DG CL E LD I  P R    P  
Sbjct: 180 VHFLPISGLLGSNMKTRMDKS--ICSWW--------DGPCLFEVLDCIEVPLRDPKGPVR 229

Query: 781 FP 786
            P
Sbjct: 230 MP 231



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 21/51 (41%), Positives = 36/51 (70%)
 Frame = +3

Query: 90  DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           D+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D  + ER
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEER 54


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 33/81 (40%), Positives = 52/81 (64%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+A  G          QT+EH L
Sbjct: 124 EYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMP-------QTKEHIL 176

Query: 454 LAFTLGVKQLIVGVNKMDSLN 516
           LA  +GV  L+  +NK+D+++
Sbjct: 177 LARQVGVPSLVCFLNKVDAVD 197



 Score = 34.7 bits (76), Expect = 0.099
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           + K H+N+  IGHVD GK+T T     ++ + G       ++ +K  +E  +G
Sbjct: 63  RTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEEKARG 115


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 34/87 (39%), Positives = 53/87 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G          Q
Sbjct: 121 INTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP-------Q 173

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN 516
           T+EH LLA  +GV +++V +NK D ++
Sbjct: 174 TKEHILLAKQVGVPKIVVFLNKKDQVD 200



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 197
           K  + K H+NI  IGHVD GK+T T  L   +   GG   +  ++ +   +E  +G
Sbjct: 63  KFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARG 118


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 35.9 bits (79), Expect = 0.043
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH      + +
Sbjct: 149 HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANES------CPQPQTSEHLAAVEIMRL 202

Query: 475 KQLIVGVNKMD 507
           + +I+  NK+D
Sbjct: 203 QHIIILQNKID 213


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 35.1 bits (77), Expect = 0.075
 Identities = 28/94 (29%), Positives = 41/94 (43%)
 Frame = +1

Query: 232 RLSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 411
           R+S+    + + L       Y   I+D PGH +F   M      AD AVL+V A      
Sbjct: 199 RVSIKAVPMSLVLEGGNGKSYLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAA----- 253

Query: 412 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSL 513
            G+  N    E A+   T     ++V +NK+D L
Sbjct: 254 EGVMVN---TERAIRHATQERLPIVVVINKVDRL 284


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 22/70 (31%), Positives = 30/70 (42%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G +  D  VL+VAA  G     +    +   HA  A      
Sbjct: 247 ITFLDTPGHAAFSAMRARGAAVTDIVVLVVAADDGVMPQTL----EAMSHAKAANV---- 298

Query: 478 QLIVGVNKMD 507
            ++V VNK D
Sbjct: 299 PIVVAVNKCD 308


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 27/93 (29%), Positives = 41/93 (44%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           +   Y + +ID PGH DF   +    +    A+L+V A  G          QT  +  LA
Sbjct: 130 DAPSYLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQG-------VQAQTIANFYLA 182

Query: 460 FTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRK 558
           F   +  +I  +NK+D     T  PD  K++ K
Sbjct: 183 FESNL-SIIPVINKID---QPTADPDNVKAQLK 211


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           Y V IID PGH DF   +       D A+L++ +  G     I+ + Q R + +
Sbjct: 136 YQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQMRRYEI 189



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGI 143
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTGRI 95


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 31.9 bits (69), Expect = 0.70
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           N  ++ HVD GK+T   HL+  CG
Sbjct: 12  NTCILAHVDHGKTTLADHLVASCG 35



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           V +ID+PGH DF   + +    +D A+++V A  G
Sbjct: 77  VNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEG 111


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 26/78 (33%), Positives = 36/78 (46%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           +ID PGH  F      G S  D AV++V     +   G+ K  QT E   L     V+ +
Sbjct: 507 VIDTPGHESFSNMRSRGMSLCDIAVVVV-----DIMHGLEK--QTVETLALLKDRNVRFI 559

Query: 484 IVGVNKMDSLNHHTVSPD 537
           +V +NK+D L      PD
Sbjct: 560 VV-LNKVDRLCGWKHCPD 576


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           V +ID+PGH DF   +      AD A+++V A  G
Sbjct: 89  VHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 188
           N  ++ HVD GK++   HLI   G  ++R  E+    A+ M
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS-ERRVSERMAGSARVM 57


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           N+ VI HVD GK+T    L+ +CG
Sbjct: 66  NVAVIAHVDHGKTTLMDRLLRQCG 89



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           + ++D PGH DF   +       + AVL+V AG G
Sbjct: 125 LNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEG 159


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +3

Query: 15  QFVIRD*PKMGKEKTHI-NIVVIGHVDSGKSTTTGHLIYKCG 137
           +F + +  ++  +K +I N+ VI HVD GKST T  L+   G
Sbjct: 3   KFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 286 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +3

Query: 15  QFVIRD*PKMGKEKTHI-NIVVIGHVDSGKSTTTGHLIYKCG 137
           +F + +  ++  +K +I N+ VI HVD GKST T  L+   G
Sbjct: 3   KFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 286 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>05_05_0202 -
           23211342-23211385,23211493-23211579,23211666-23211779,
           23211886-23212111,23212222-23212401,23212511-23212654,
           23212818-23212979,23213093-23213296,23214109-23214156,
           23214601-23214846
          Length = 484

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +3

Query: 507 FTEPPYSEPRFEEIKKEVSSYIKKIGLQPSCCRFRAHFWMARRQHVGAF 653
           +T PPY  PR EEI ++ + +     L PS   F    W  R    G++
Sbjct: 50  YTPPPYDGPRAEEISRKRAEF-----LSPSLFHFYDRPWAYRHPRFGSY 93


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +3

Query: 60  HINIVVIGHVDSGKSTTTGHLIYKCG 137
           HI+ V++ H+D+GK+TTT  ++Y  G
Sbjct: 105 HIS-VIMAHIDAGKTTTTERVLYYTG 129


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)
 Frame = +1

Query: 235 LSVXRYQIDIALWKFETSK----YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           +S+     D AL  FE  +    Y + +ID+PGH DF   +       D A+++V
Sbjct: 75  ISLYYEMTDAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALRITDGALVVV 129



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+   G
Sbjct: 13  MDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAG 44


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           +ID PGH+ F      G+S  D A+L+V
Sbjct: 489 VIDTPGHQSFSNLRTRGSSLCDIAILVV 516


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 164
           N  +I H+D GKST    L+   G + KR +++
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKREMKQ 111



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           Y + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 143 YCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 179


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ V+ HVD GKST T  L+   G
Sbjct: 13  MDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 286 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>09_06_0237 + 21788886-21789965
          Length = 359

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 22/97 (22%), Positives = 41/97 (42%), Gaps = 9/97 (9%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF----EAGI-----SKNGQTREHALL 456
           +I    +  F + ++   SQ DC   +V  G G F     AG+       N      A++
Sbjct: 261 VIRRSWNETFPRELVAAHSQYDCPGNLVYVGDGRFCICWVAGVEHDRPETNDMVARTAVV 320

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPH 567
              + +++   G  ++  L +H +SP  R++    PH
Sbjct: 321 TMAVRLRRSAGGELQLTKLRYHLMSPQGRRAYFVQPH 357


>07_03_1637 +
           28293033-28293779,28294652-28295233,28295650-28295863,
           28295894-28295911,28295983-28296118,28296203-28296281
          Length = 591

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = -3

Query: 789 CREDAGACQGXGRWQDGI-ESFNEAFS 712
           C ED G C G G W+  I E FNEAF+
Sbjct: 60  CPEDDGGC-GGGGWKVAIAEMFNEAFA 85


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           +ID PGH  F      G+S  D A+L+V
Sbjct: 766 VIDTPGHESFSNLRSRGSSLCDIAILVV 793


>01_01_0016 - 88825-90411
          Length = 528

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 489 YDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSA 370
           YD  F     + +G+L  L+V+    F+ TGT + D+H A
Sbjct: 241 YDAAF--RDHARRGLLPALSVIEPRYFDLTGTPADDDHPA 278


>08_01_0560 -
           4954479-4954746,4955106-4955167,4955208-4955284,
           4955421-4955541
          Length = 175

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = +3

Query: 474 QTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKK-IGLQPSCC 602
           Q  H    Q     PP  +PR E +++++S+ I+K  G++P  C
Sbjct: 108 QYNHIVPPQPPILRPPNPQPRPENMEEQISNIIRKAFGIEPRNC 151


>07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950
          Length = 346

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -1

Query: 680 HPLNQGILVEGSNMLSPCHPEMGTKATAAG 591
           HP    +L  G N L+ C+P   + AT AG
Sbjct: 258 HPSLNQLLGVGDNFLAECYPSTASTATVAG 287


>10_08_0035 -
           14321699-14321751,14321800-14321914,14322136-14322199,
           14322221-14322238,14323433-14323524,14323580-14323601,
           14324345-14324424,14324882-14325082
          Length = 214

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = +1

Query: 676 GWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           GW+  R+   A G  L+      L P  PL+ P V PARR
Sbjct: 9   GWRRRRRRSAAIGGQLLLPPLFWLFPLSPLSRPMVMPARR 48


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,144,951
Number of Sequences: 37544
Number of extensions: 557438
Number of successful extensions: 1664
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 1554
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1633
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2479731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -