SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30146.Seq
         (330 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0206 + 1487034-1489430                                           27   2.7  
04_01_0492 + 6476586-6476873,6477414-6477686,6477769-6477948,647...    27   2.7  
04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296     26   6.2  
10_08_0569 + 18844910-18845249,18845353-18845471,18846557-18846568     26   8.3  
01_05_0128 + 18413029-18413318,18413946-18414139,18414447-18414553     26   8.3  

>05_01_0206 + 1487034-1489430
          Length = 798

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 21  KCWGPRGGXVAA 56
           +CWGPRGG V A
Sbjct: 161 RCWGPRGGAVEA 172


>04_01_0492 +
           6476586-6476873,6477414-6477686,6477769-6477948,
           6478436-6478696,6479171-6479303,6479404-6479494,
           6479921-6480023,6480557-6480660,6480809-6480902,
           6480985-6481140,6481224-6481286,6481388-6481453,
           6481670-6481870,6481999-6482076,6482165-6482284,
           6482382-6482462,6482548-6482633,6482920-6483031,
           6483093-6483170,6483306-6483482
          Length = 914

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 107 MSLTRYRXGPPPHSRGVGG 163
           MS    R  PPPH  GVGG
Sbjct: 1   MSTAARRGHPPPHENGVGG 19


>04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296
          Length = 191

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 9/11 (81%), Positives = 9/11 (81%)
 Frame = +2

Query: 134 PPPHSRGVGGG 166
           PPPH RG GGG
Sbjct: 108 PPPHQRGGGGG 118


>10_08_0569 + 18844910-18845249,18845353-18845471,18846557-18846568
          Length = 156

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 2/20 (10%)
 Frame = +2

Query: 137 PPH--SRGVGGGDXLVYRLH 190
           PPH  +   GGGD L +RLH
Sbjct: 2   PPHEDTLDAGGGDVLTFRLH 21


>01_05_0128 + 18413029-18413318,18413946-18414139,18414447-18414553
          Length = 196

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 12/45 (26%), Positives = 20/45 (44%)
 Frame = +1

Query: 10  NYKRSVGGLAVAXWRRDHRHSIYXDIRLFKSNNVTNAVSXRTPAA 144
           NY    GGL ++  +R+ R   +  + +F S  +        PAA
Sbjct: 105 NYSPLGGGLLISGMQRELRRDGWIGLAVFSSGRIWGVAGHPAPAA 149


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,475,611
Number of Sequences: 37544
Number of extensions: 93598
Number of successful extensions: 259
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 259
length of database: 14,793,348
effective HSP length: 72
effective length of database: 12,090,180
effective search space used: 447336660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -