SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30142.Seq
         (600 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1068 + 8715714-8716799,8716899-8717159                           29   2.2  
01_01_1213 - 9769268-9769975                                           27   8.7  

>06_01_1068 + 8715714-8716799,8716899-8717159
          Length = 448

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +1

Query: 517 PPPCVPXXGXGRRSQASRCTW 579
           PPP VP  G GRR +A    W
Sbjct: 68  PPPLVPPSGSGRRDEAVPAAW 88


>01_01_1213 - 9769268-9769975
          Length = 235

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 469 VYPLGNTSIFVTSRTXPPPCVPXXGXGRRSQASRCT 576
           V P  +TS F+  R  PPP  P    GR++  +  T
Sbjct: 156 VLPTLDTSAFLLDRASPPPPPPQPQPGRKNDKTPTT 191


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,366,781
Number of Sequences: 37544
Number of extensions: 164565
Number of successful extensions: 259
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 259
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1435654836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -