SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626...    31   1.2  
06_02_0109 - 11919279-11920109                                         30   2.2  
04_04_0042 + 22328464-22329858                                         30   2.2  
01_06_1331 + 36373059-36373338,36374190-36374263,36374530-363746...    29   3.8  
05_03_0573 - 15635338-15635502,15637573-15637632,15637776-15638033     29   5.0  
12_02_1270 + 27466516-27466621,27466722-27466885,27467385-274681...    29   6.6  
12_02_0754 - 22817277-22817657,22817796-22817927,22818026-228182...    28   8.8  
05_07_0095 - 27659944-27660795,27660900-27661172,27661280-276613...    28   8.8  
05_04_0302 - 20004802-20005360,20005412-20005623                       28   8.8  

>10_08_0683 -
           19860777-19861070,19861677-19861874,19862498-19862659,
           19862763-19862911,19863089-19863236,19863317-19863385,
           19863471-19863719,19863937-19864131,19864444-19864560,
           19864978-19866537
          Length = 1046

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -1

Query: 693 PNTSISVSQSDTDVQRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPILPTSGAATSR 514
           PN S S+S S +    P    P  ++PS+P        ++ V DR   P  P+  A  + 
Sbjct: 114 PNPSPSISPSSSFHHHPEPPSPSPSAPSYPSI-ADGLANMHVSDRHDYPPPPSPAAVPAA 172

Query: 513 TNPRIGP 493
           ++P + P
Sbjct: 173 SSPSVLP 179


>06_02_0109 - 11919279-11920109
          Length = 276

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 7/56 (12%)
 Frame = -2

Query: 338 ALGDSGHRERHSLGRFNVLAHRV-----QCHHFRDIRWTSVTR--HQAHAHPPTMV 192
           AL D         G  + L HR+     Q HH+  +   ++ R    AHA PPTMV
Sbjct: 69  ALDDISRSPDKKPGELHALDHRISSILQQYHHYNHVASNNIHRDYRDAHAPPPTMV 124


>04_04_0042 + 22328464-22329858
          Length = 464

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = -1

Query: 630 PLRTSPSWPRYWTSS*TSLIVKDR-ISIPILPTSGAATSRTNPRIGP 493
           P+R  P +P Y+  +   L++ DR +S+P   T+ A  + T P   P
Sbjct: 269 PMRRDPRYPSYYYLNLDGLLIGDRAMSLPPTTTTTATATATAPAPAP 315


>01_06_1331 +
           36373059-36373338,36374190-36374263,36374530-36374699,
           36374731-36374822,36375087-36375323,36375922-36375980,
           36376462-36376644,36377347-36377437,36377959-36378002,
           36378085-36378207
          Length = 450

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%)
 Frame = +1

Query: 64  VVKCSVCIVKVTVKGFKMGNIHTVGPNEAL--IVSGGCFGPTTKRTIVGGWAWAW 222
           VV  +  +V    K +  GN  TV P   +    SG   GP+  R +   W W +
Sbjct: 161 VVMITAYLVSFVPKKYNKGNSITVSPRSQVSRTSSGAASGPSESRDLGQVWGWGY 215


>05_03_0573 - 15635338-15635502,15637573-15637632,15637776-15638033
          Length = 160

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +2

Query: 458 RNSYSRRGVQRQGPIRGLVREVAAPD 535
           R + +RRG +R G +R    EVAAPD
Sbjct: 25  RGALARRGSRRLGVVRAASAEVAAPD 50


>12_02_1270 +
           27466516-27466621,27466722-27466885,27467385-27468173,
           27468263-27468479,27469078-27469256,27470233-27470474,
           27470607-27470994
          Length = 694

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -2

Query: 176 PKQPPETISASLGPTVWMLPILNPFTVTF 90
           PK  P T  + L P VW L + NP+  +F
Sbjct: 442 PKDNPYTDDSDLEPEVWALGLRNPWRCSF 470


>12_02_0754 -
           22817277-22817657,22817796-22817927,22818026-22818272,
           22818473-22818909
          Length = 398

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = +1

Query: 52  VIVLVVKCSVCIVKVTVKGFKMGNIHTVGPNEAL 153
           V++  +KC  C+ K+ +  F  GN+  +  N +L
Sbjct: 255 VVIDFIKCFPCVEKLYIVAFNQGNLKNIRRNVSL 288


>05_07_0095 -
           27659944-27660795,27660900-27661172,27661280-27661354,
           27661683-27661837,27661935-27662051,27662148-27662487
          Length = 603

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +2

Query: 551 IEILSFTIKDVYDDVQYLGQLGEVRNGQREEG-R*TSVSLWLTEMLVLGKRX*EKRNGR 724
           +E L+FT+    +DV +   L +  N + +E  R  S+S + T+ +V+  +   +R GR
Sbjct: 475 LESLAFTVMSRIEDVLHADSLAQASNTRTQESMRMASLSRYDTDKVVIDAKAEVERLGR 533


>05_04_0302 - 20004802-20005360,20005412-20005623
          Length = 256

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 12/19 (63%), Positives = 12/19 (63%)
 Frame = -1

Query: 657 DVQRPSSRWPLRTSPSWPR 601
           D  RPSSRW  R S SW R
Sbjct: 76  DRDRPSSRWRWRYSSSWQR 94


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,526,638
Number of Sequences: 37544
Number of extensions: 619758
Number of successful extensions: 1938
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1934
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2530383840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -