SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_04_0281 + 15733505-15733647,15734366-15734443,15734835-157350...    54   8e-08
10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289,381...    53   2e-07
05_06_0033 + 25074301-25074393,25074680-25075203,25076367-250764...    53   2e-07
02_04_0319 - 22006550-22006952,22007260-22007441,22007522-220077...    53   3e-07
07_01_0426 + 3239274-3239386,3239472-3239702,3242516-3242642,324...    51   8e-07
12_02_1151 + 26488686-26488792,26488897-26489142,26490246-264903...    50   2e-06
02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931,813...    50   2e-06
04_04_1365 - 32967604-32968367,32969097-32969221,32969583-32969632     50   2e-06
08_02_1014 - 23586552-23587224,23587402-23587463,23587735-235879...    48   7e-06
09_04_0435 - 17545879-17546605,17546721-17546782,17547123-175473...    48   9e-06
03_01_0641 - 4697273-4697672,4697921-4698102,4698218-4698403,469...    44   1e-04
06_03_0968 - 26402154-26403834,26404322-26404383,26404473-264046...    44   2e-04
04_04_0075 - 22542486-22542882,22543181-22543362,22543452-225436...    44   2e-04
09_04_0652 - 19227686-19227926,19229368-19232294                       40   0.002
06_01_0588 - 4224348-4224516,4224674-4224767,4224872-4225490,422...    40   0.002
08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224     38   0.006
02_05_0382 + 28491318-28491374,28492031-28492114,28492249-284922...    37   0.018
02_05_1059 + 33815979-33816235,33816467-33816732,33817149-338171...    36   0.031
08_02_1340 - 26256768-26256999,26258105-26258774,26259273-262605...    35   0.054
03_01_0658 + 4818401-4818540,4818605-4819201,4819694-4819949,482...    35   0.054
08_02_1342 - 26268552-26268783,26270213-26271137,26271680-26272907     33   0.29 
08_02_1336 - 26233081-26233312,26233814-26234672,26235218-26236736     33   0.29 
08_02_1345 - 26286448-26286679,26287483-26288038,26288068-262883...    32   0.50 
09_02_0557 + 10639845-10639900,10640372-10640647,10640998-10641283     31   0.66 
08_02_1343 - 26274788-26275019,26275972-26276611,26277174-262783...    31   1.2  
01_06_0864 - 32546696-32546803,32546881-32546961,32547134-325472...    31   1.2  
06_01_0976 - 7576334-7579090,7581001-7581150,7581236-7581850           30   1.5  
08_02_1337 - 26238506-26238737,26239728-26240703,26241266-26242802     30   2.0  
07_01_0454 + 3443871-3444024,3444268-3444356,3445482-3445557,344...    30   2.0  
08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686     29   3.5  
07_01_1093 + 10033403-10033984                                         29   4.7  
12_02_0381 + 18376045-18376114,18376270-18376420,18376524-183766...    28   6.2  
11_06_0151 - 20643032-20643085,20643202-20643307,20643415-206434...    28   8.1  
04_03_0937 + 20923705-20923833,20924001-20924012,20924413-209244...    28   8.1  

>11_04_0281 + 15733505-15733647,15734366-15734443,15734835-15735077,
            15735868-15736012,15736234-15736293,15736376-15736471,
            15736651-15737067,15737824-15737964,15738043-15738213,
            15738394-15738651,15738741-15738889,15739060-15739557,
            15740147-15740420,15740631-15740696,15740891-15741057,
            15741413-15741497,15741673-15741732
          Length = 1016

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 36/111 (32%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = +3

Query: 300  GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            G  +SL  CL AF   + L  ++M+ C RCK+ R   K   +  LP VL +HLKRF    
Sbjct: 776  GEPLSLYSCLDAFLREEPLVPEDMWYCPRCKEQRQASKKLDLWRLPEVLVIHLKRFSFSR 835

Query: 480  LFSAKVXXXXXXXXTIW--T*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
                K+          +  T  +   KS+ R +  Y L AV +H G++  G
Sbjct: 836  STKQKLETFVNFPIHDFDLTNYIANKKSSERQI--YELYAVSNHYGSMASG 884



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           SII DV  G+  S + C  C +VS   + F  LSLP+
Sbjct: 491 SIIVDVCQGQYKSTLVCPACGKVSVTFDPFMYLSLPL 527


>10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289,
            3812602-3812747,3812930-3813097,3813896-3814003,
            3814859-3815029,3816557-3816949,3817522-3817617,
            3817715-3817774,3818600-3818744,3819296-3819520,
            3820106-3820254
          Length = 890

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 34/106 (32%), Positives = 46/106 (43%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L  CL AF   + L  D+M+ C RC + +   K   +  LP +L VHLKRF +     
Sbjct: 719  VNLFSCLDAFLKDEPLGPDDMWYCPRCTEHKQASKKLDLWRLPEILVVHLKRFSYSRFMK 778

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                   S       Y L AVI+H G +GGG
Sbjct: 779  NKLDTFVNFPIHDLDMSRYANHSRGDQPPIYELYAVINHYGGMGGG 824



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +1

Query: 91  GKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           G+  S + C  C ++S   + F  LSLP+PS
Sbjct: 450 GQYKSTLVCPDCKKISVTFDPFMYLSLPLPS 480


>05_06_0033 +
           25074301-25074393,25074680-25075203,25076367-25076442,
           25076549-25076641,25077167-25077253,25077338-25078095,
           25078447-25078575,25079145-25079265
          Length = 626

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+ D LA FF  + L+G N YSC RCKKL +  K   ++  P VL + LKRF
Sbjct: 182 SVADALARFFQPEILEGSNKYSCERCKKLTSARKQLFVLRAPKVLVIQLKRF 233



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = +1

Query: 28  SGSSGDGSNVKYR-----SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           S ++GD    + R      ++ + F G LLS V+CL C   S + +   D+SL +P    
Sbjct: 123 SNANGDAGEEEVRVQGPYMVMKETFGGALLSQVKCLTCKGESNKTDEIMDISLDLPGSNS 182

Query: 193 LA 198
           +A
Sbjct: 183 VA 184


>02_04_0319 -
           22006550-22006952,22007260-22007441,22007522-22007704,
           22008144-22008242,22008999-22009115,22010476-22010739
          Length = 415

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 31/101 (30%), Positives = 47/101 (46%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL  CL +FFS + L G++ + C +C  L+   K   I   P VL +HLKRF++    S 
Sbjct: 255 SLTSCLKSFFSTEILNGEDKFFCDKCSSLQEAHKRMKIKKAPHVLVIHLKRFKYVEQLS- 313

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
                      ++   L     +      YSL AV+ H+G+
Sbjct: 314 --RHKKLSYRVVYPLELKLGSMSEDADCEYSLFAVVVHVGS 352



 Score = 35.9 bits (79), Expect = 0.031
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           +++   F G L +  +CL+CD ++ + ETF DLS+ +     L
Sbjct: 214 TLVHRTFQGILTNETKCLMCDTITAKDETFFDLSIDVEQNSSL 256


>07_01_0426 + 3239274-3239386,3239472-3239702,3242516-3242642,
            3242729-3242788,3242868-3242960,3243073-3243369,
            3243450-3243761,3243857-3244114,3244227-3244375,
            3244470-3245102,3245367-3245640,3245736-3245777,
            3246332-3246586,3246700-3246711
          Length = 951

 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 31/106 (29%), Positives = 47/106 (44%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L  CL AF   + L  ++M+ C  CKK +  +K   +  LP VL +HLKRF +     
Sbjct: 737  VALHGCLEAFLKEEPLGPEDMWYCPCCKKHQQAMKKLDLWRLPEVLVIHLKRFSYTQFTR 796

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+        +           +      Y L A+ +H G +GGG
Sbjct: 797  NKLETFVDFPISDLDLSSYIIDKSELSDCHYRLYAISNHYGNMGGG 842



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I D + G+  S + C  C + S   + F  LSLP+PS
Sbjct: 404 SVIVDTYHGQYKSTLTCPTCSKTSVTFDPFMYLSLPVPS 442


>12_02_1151 + 26488686-26488792,26488897-26489142,26490246-26490381,
            26490502-26490561,26490648-26490740,26491421-26491663,
            26491828-26491968,26492312-26492482,26492813-26492899,
            26492954-26493211,26493300-26493445,26493535-26493922,
            26493935-26494092,26494267-26494540,26494721-26494894
          Length = 893

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 30/105 (28%), Positives = 46/105 (43%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            SL  CL AF   + L  ++M+ C  CK+ R   K   +  LP +L +HLKRF +      
Sbjct: 725  SLYACLEAFIKEEPLGPEDMWYCPGCKEHRQASKKLDLWRLPEILIIHLKRFSYSRYTKN 784

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                      +  + Y L A+ +H G++GGG
Sbjct: 785  KLETCVDFPVHDLDLSKYIGSRGQQISNHYRLYAISNHYGSMGGG 829



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 91  GKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           G+  S + C  C +VS   + F  LSLP+PS
Sbjct: 429 GQYKSTLVCPDCRKVSVTFDPFMYLSLPLPS 459


>02_02_0236 +
           8135641-8135795,8136167-8136557,8136640-8136931,
           8137117-8137271,8137363-8137451,8137623-8137967,
           8139046-8139169,8139424-8139581,8139673-8139757,
           8140094-8140306,8141314-8141375,8141466-8141951,
           8142472-8142568
          Length = 883

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/58 (41%), Positives = 33/58 (56%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G V SLQD L  F + ++L G+NMY C RC       K   +  +P +L V LKRF+
Sbjct: 541 HGWVESLQDALTQFTAPEDLDGENMYKCGRCSAYVKARKQLSVHEVPNILTVVLKRFQ 598



 Score = 34.7 bits (76), Expect = 0.071
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++++  ++I  +F G+L S V+CL C   S R E   DL+L I
Sbjct: 498 ASLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEI 540


>04_04_1365 - 32967604-32968367,32969097-32969221,32969583-32969632
          Length = 312

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 22/56 (39%), Positives = 30/56 (53%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V +L  CL  F  A+ L  +  + C RCK+ +  +K   I  LP V C H+KRF H
Sbjct: 131 VSTLMRCLERFTRAERLDAEQKFFCERCKERQESLKQMSIRRLPLVSCFHIKRFEH 186


>08_02_1014 -
           23586552-23587224,23587402-23587463,23587735-23587950,
           23588125-23588209,23589232-23589389,23589505-23589625,
           23590081-23590243,23590330-23590415,23590660-23590742,
           23590816-23591677,23593266-23593693
          Length = 978

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 24/57 (42%), Positives = 30/57 (52%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + SL+  L  F S + L GDN Y CSRCK      K   I   P VL + LKR++
Sbjct: 606 GDISSLEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKRYQ 662


>09_04_0435 -
           17545879-17546605,17546721-17546782,17547123-17547335,
           17547506-17547590,17547904-17548061,17548174-17548294,
           17548765-17548927,17548973-17549097,17550800-17550888,
           17550970-17551636,17552671-17552717,17553506-17553862
          Length = 937

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + +L++ L  F S + L GDN Y+CSRCK      K   I   P +L + LKR++
Sbjct: 548 GDINTLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQ 604


>03_01_0641 -
           4697273-4697672,4697921-4698102,4698218-4698403,
           4699287-4699385,4700028-4700144,4700698-4700814
          Length = 366

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH-ELLFS 488
           S+  CL  F S + L  ++ + C +C  L+   K   I   P +L +HLKRF++ E L  
Sbjct: 207 SITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKPPNILVIHLKRFKYIEQLGR 266

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            K          ++   L    +       YSL AV+ H+G+
Sbjct: 267 YK----KLSYRVVFPLELKLINTVDNSDLEYSLFAVLVHVGS 304



 Score = 34.3 bits (75), Expect = 0.094
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +++   F G L +  +CL C+ V+ R ETF DLSL I
Sbjct: 166 TLVHKCFQGILTNETRCLRCETVTDRDETFFDLSLDI 202


>06_03_0968 -
           26402154-26403834,26404322-26404383,26404473-26404682,
           26404776-26404860,26405461-26405618,26405745-26405868,
           26405955-26406123,26406202-26406287,26406379-26406467,
           26406564-26406735,26407820-26408193
          Length = 1069

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G   SL++CL  F + + L GDN Y C  C       K   +   P +L + LKRF+
Sbjct: 362 HGDADSLEECLDKFTAVEWLDGDNKYKCDGCSDYVKAQKRLTVYQAPNILTITLKRFQ 419



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++I  +F G+L S VQC  C  VS R E   DL++ I
Sbjct: 325 TLIQHIFGGRLQSQVQCTACGMVSNRYENMMDLTVEI 361


>04_04_0075 -
           22542486-22542882,22543181-22543362,22543452-22543637,
           22543959-22544057,22546198-22546314,22547739-22547855
          Length = 365

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH-ELLFS 488
           S+  CL  F S + L  ++ + C +C  L+   K   I   P +L +HLKRF++ E L  
Sbjct: 207 SITSCLKNFCSTETLNAEDKFFCDKCCSLQEAQKRMKIKKAPHILVIHLKRFKYIEQLGR 266

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            K          ++   L +  ++    + YSL AV+ H+G+
Sbjct: 267 YK----KLSYRVVFPMEL-KLSTSDDVDTEYSLFAVVVHVGS 303



 Score = 32.7 bits (71), Expect = 0.29
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +++   F G L +  +CL C+ V+ R ETF DLS+ I
Sbjct: 166 TLVHKNFQGILTNETRCLRCETVTARDETFFDLSVDI 202


>09_04_0652 - 19227686-19227926,19229368-19232294
          Length = 1055

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 43  DGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           + S+    +I+  +F G+L S V    C   S + + F DLSLP+PSR
Sbjct: 332 EASSATIPTIVDSIFGGQLSSTVSSTECTHSSVKHDQFLDLSLPVPSR 379


>06_01_0588 -
           4224348-4224516,4224674-4224767,4224872-4225490,
           4225609-4225734,4225819-4226487,4226728-4226853,
           4226940-4227266,4227366-4227439,4228469-4228583,
           4228871-4229164
          Length = 870

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +1

Query: 13  SARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S + KS    +  +   +S++  +F G+L S V+C  C   S + + F DLSL I
Sbjct: 130 SGKHKSSLPSESPSAYEKSLVHKIFGGRLRSQVKCTQCSHCSNKFDPFLDLSLDI 184



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = +3

Query: 339 FSADELK--GDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F+A+EL   G+  Y C RC+K     K   I   P VL +HLKRF
Sbjct: 197 FTAEELLDGGEKQYQCQRCRKKVVAKKKFTIDKAPYVLTIHLKRF 241


>08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224
          Length = 787

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 3/105 (2%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSAD--ELKGDNMYSCSR-CKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           + S+++CL   F A+  EL  +N   CS+  +KL   V  + + +LP VL +HLKR    
Sbjct: 632 LASIEECLELHFEAETVELTCEN---CSKFAQKLNKSVIQTRLSLLPPVLVIHLKR---S 685

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           LL S KV         +         S  +  S Y L +VI H G
Sbjct: 686 LLQSDKVKGHVSFKEILDVGLFMDPSSVDKDNSIYRLASVIEHHG 730


>02_05_0382 +
           28491318-28491374,28492031-28492114,28492249-28492272,
           28492398-28492472,28493083-28493157,28493198-28493290,
           28493332-28493409,28493690-28493767,28494084-28494147,
           28494474-28494655,28494729-28495064,28495148-28495267,
           28495434-28495923,28496240-28496502
          Length = 672

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           S+    SI+  VF G+L S + C  C   S   E F DLSL I   ++L
Sbjct: 251 SSFDEESIVKQVFGGRLKSKLTCCECGHCSETYEPFLDLSLEIDQADNL 299


>02_05_1059 +
           33815979-33816235,33816467-33816732,33817149-33817192,
           33817363-33817539,33817638-33817964,33818067-33818192,
           33818518-33818622,33818815-33820125,33820221-33820382,
           33820416-33820517,33820549-33821272,33821358-33821451,
           33821824-33821986
          Length = 1285

 Score = 35.9 bits (79), Expect = 0.031
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +1

Query: 28  SGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           SG      +   +S++  +F G L S V+C  C   S + + F DLSL I
Sbjct: 222 SGVPSGSPSAYEKSLVHRIFGGLLRSQVRCTTCSHCSNKFDPFLDLSLEI 271



 Score = 34.3 bits (75), Expect = 0.094
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = +3

Query: 339 FSADELK--GDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F+A+EL   G+  Y+C  C++     K   I   P VL +HLKRF
Sbjct: 284 FTAEELLDGGEKQYNCEHCRQKVVAKKRFMIEKAPSVLTIHLKRF 328


>08_02_1340 -
           26256768-26256999,26258105-26258774,26259273-26260555,
           26262403-26263499
          Length = 1093

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++I  +F G+L   + C  C   S   E F DLS+P+P +
Sbjct: 686 TVIDSIFAGQLSVTLSCKCCSFKSDSEEVFHDLSMPLPPK 725


>03_01_0658 +
           4818401-4818540,4818605-4819201,4819694-4819949,
           4820038-4820723,4821009-4821147,4821378-4821514,
           4821805-4822077,4822175-4822382,4822660-4822731,
           4823230-4823460,4824269-4824532,4825127-4825268,
           4825355-4825467
          Length = 1085

 Score = 35.1 bits (77), Expect = 0.054
 Identities = 16/52 (30%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +L+  L  + S + L G+N Y C  C+K  +  +   +  LP V+   LKR+
Sbjct: 275 NLEQSLDDYLSTEALDGENQYFCESCQKRVDATRCIKLRSLPPVVNFQLKRY 326


>08_02_1342 - 26268552-26268783,26270213-26271137,26271680-26272907
          Length = 794

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAV 201
           ++   +F G+L S + C  C   S     F DLS+P+P  +  ++
Sbjct: 307 TVTDSIFGGQLSSHISCKCCSFSSVSHVAFHDLSVPLPPTQSKSI 351


>08_02_1336 - 26233081-26233312,26233814-26234672,26235218-26236736
          Length = 869

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           +++  +F  +L + + C  C   S   E   DLS+P+PSR
Sbjct: 411 TVVDSIFRVQLSATISCRRCSYNSVSHEVMYDLSVPLPSR 450


>08_02_1345 -
           26286448-26286679,26287483-26288038,26288068-26288358,
           26288953-26290516
          Length = 880

 Score = 31.9 bits (69), Expect = 0.50
 Identities = 15/56 (26%), Positives = 25/56 (44%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHH 234
           ++ + +F G+L     C  C   S     F DLS+P+P ++  A      P +  H
Sbjct: 415 TVFNSIFGGQLFVTRSCKCCSFCSVSHAVFYDLSVPVPPKKPPAKSVESTPWIEGH 470


>09_02_0557 + 10639845-10639900,10640372-10640647,10640998-10641283
          Length = 205

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +3

Query: 378 CSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           C  CKK +  +K   +  LP VL +HLKRF +
Sbjct: 113 CPCCKKHQQAMKKLDLWRLPEVLVIHLKRFSY 144


>08_02_1343 -
           26274788-26275019,26275972-26276611,26277174-26278367,
           26278515-26278701
          Length = 750

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           ++I  +F G+L     C  C   S   + F DLS+P+P
Sbjct: 361 TVIDSIFGGQLSVTSSCKHCSVRSLSHDVFHDLSVPLP 398


>01_06_0864 -
           32546696-32546803,32546881-32546961,32547134-32547250,
           32548264-32548338,32548618-32548680,32549122-32549187,
           32549254-32549325,32549403-32549504,32549588-32549765,
           32549871-32549926,32551578-32551688,32551797-32551865,
           32551960-32552068,32552176-32552327,32552398-32552475,
           32554257-32554379,32555527-32555646,32555729-32555809,
           32555881-32556027,32556112-32556190,32557223-32557297,
           32558004-32558113,32558984-32559082,32559700-32559815,
           32559914-32560022,32560098-32560229,32560389-32560591,
           32561428-32561585,32561668-32561797,32562529-32562607,
           32562806-32562829
          Length = 1073

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  STR E+F DL+L +
Sbjct: 250 IQQLFEGHHMNYIECINVDYKSTRKESFYDLALDV 284


>06_01_0976 - 7576334-7579090,7581001-7581150,7581236-7581850
          Length = 1173

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +1

Query: 148  ETFQDLSLPIPSREHLAVLRCQQPMLNHHA 237
            +TF  L+ P+P   H+  L+  QP+  HHA
Sbjct: 1042 QTFAPLTSPLPCDVHVVNLKAPQPLKFHHA 1071


>08_02_1337 - 26238506-26238737,26239728-26240703,26241266-26242802
          Length = 914

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++I  +F  +L     C  C   S   + F DLS+P+P +
Sbjct: 421 TVIDSIFGSELSVTTSCKRCSFKSYSCDVFYDLSVPLPPK 460


>07_01_0454 +
           3443871-3444024,3444268-3444356,3445482-3445557,
           3445875-3445880,3445984-3446131,3446237-3446394,
           3446473-3446676,3446803-3447038,3447227-3447439,
           3447984-3448082,3448262-3448371,3448581-3448655,
           3449407-3449485,3449563-3449709,3449785-3449865,
           3449975-3450094,3450580-3450702,3451382-3451459,
           3451586-3451674,3451760-3451868,3452117-3452227,
           3452557-3452612,3452697-3452874,3452971-3453072,
           3453160-3453231,3453350-3453415,3453502-3453567,
           3453676-3453759,3454638-3454754,3455753-3455827,
           3455912-3455995,3456138-3456179
          Length = 1148

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 34/117 (29%), Positives = 49/117 (41%), Gaps = 10/117 (8%)
 Frame = +3

Query: 306 VVSLQDCLAAF---FSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           V   QD  A+F      + L+GDN Y   +   L++  K    +  P VL + LKRF ++
Sbjct: 395 VKGCQDVYASFDKYVEVERLEGDNKYHAEQYG-LQDAKKGVLFIDFPPVLQLQLKRFEYD 453

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTR------TKSAPRXVSR-YSLXAVISHMGTVGGG 626
            +    V         I    L R      +  A R V   Y+L +V+ H G V GG
Sbjct: 454 FMRDTMVKINDRYEFPIQL-DLDRDDGKYLSPDADRNVRNLYTLHSVLVHSGGVHGG 509


>08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686
          Length = 959

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 11/39 (28%), Positives = 21/39 (53%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           +++  +F  +L + + C  C   S   E   +LS+P+PS
Sbjct: 448 TVVDSIFRVQLSATISCSHCSYNSVSHEVMYELSVPLPS 486


>07_01_1093 + 10033403-10033984
          Length = 193

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +2

Query: 410 EAIRHRGAARXAVRPLEAL-PARAAVQRQGGRQXAFPINDL 529
           EA R+ G  +   R LEA  PARA +QR  GR+   P   L
Sbjct: 33  EAGRYSGEEQWPGRGLEAREPARARIQRASGREAERPARRL 73


>12_02_0381 +
           18376045-18376114,18376270-18376420,18376524-18376681,
           18378680-18378945,18379025-18379243,18379309-18379417,
           18379488-18379603,18379935-18380033,18381447-18381556,
           18382928-18383006,18383127-18383273,18383363-18383443,
           18383529-18383648,18383902-18384024,18384276-18384353,
           18384459-18384547,18384653-18384761,18385018-18385086,
           18385200-18385310,18385657-18385712,18385808-18385985,
           18386065-18386166,18386243-18386314,18386489-18386554,
           18386674-18386739,18386853-18386936,18387080-18387196,
           18388077-18388163,18389321-18389341
          Length = 1050

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  S R E+F DL L +
Sbjct: 296 IEQLFEGHHINYIECINVDYKSNRKESFYDLQLDV 330


>11_06_0151 -
           20643032-20643085,20643202-20643307,20643415-20643495,
           20643588-20643715,20643829-20643903,20644853-20645374,
           20646622-20646687,20647990-20648076,20648173-20648247,
           20648705-20648821,20648932-20649015,20649152-20649217,
           20649352-20649417,20650079-20650150,20650231-20650332,
           20650428-20650605,20650700-20650755,20653159-20653269,
           20653354-20653422,20653558-20653741,20653826-20653914,
           20654070-20654147,20654509-20654631,20654755-20654874,
           20654975-20655055,20655285-20655431,20655533-20655611,
           20657114-20657223,20659138-20659236,20659467-20659582,
           20659673-20659781,20659839-20660069,20660152-20660417,
           20661349-20661506,20661601-20661751,20661897-20661966,
           20662203-20662232
          Length = 1451

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I  +F G  ++ ++C+  D  S R E+F DL L +
Sbjct: 310 IEKLFEGHHINYIECINVDYKSNRKESFYDLQLDV 344


>04_03_0937 +
           20923705-20923833,20924001-20924012,20924413-20924473,
           20924523-20924749,20924859-20925104,20925645-20925657,
           20927681-20928302,20928320-20928949,20928960-20929224
          Length = 734

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = +3

Query: 144 NRNIPRLVAADPVPGTLGRAALPAAHA 224
           +R  PRLVA D VPG   R + P A A
Sbjct: 607 SRAAPRLVACDVVPGGRSRRSPPGAAA 633


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,955,998
Number of Sequences: 37544
Number of extensions: 335580
Number of successful extensions: 1183
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1176
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1780264028
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -