SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_06_0015 - 20234231-20234344,20234846-20234902,20234968-202351...    33   0.30 
01_04_0038 - 15339047-15339230,15339683-15339741,15340031-153401...    33   0.40 
02_01_0316 + 2125283-2125687,2125768-2125881,2125986-2126099,212...    32   0.52 
06_03_1108 - 27661916-27662812,27662889-27663529,27663613-276645...    31   0.92 
10_08_0190 + 15607241-15607409,15607932-15607990,15608883-156089...    31   1.2  
12_01_0193 + 1436165-1437247                                           31   1.6  
10_02_0053 + 4607915-4608635,4609422-4609681,4609984-4610028           31   1.6  
05_05_0348 + 24271764-24271898,24273055-24273144,24273205-242733...    31   1.6  
02_05_0226 + 26971851-26972034,26972734-26972834,26972876-269729...    29   3.7  
04_03_0284 + 13896307-13896765                                         29   4.9  
03_02_1010 - 13194002-13194339,13194421-13194573,13194661-131948...    29   4.9  
08_02_1473 - 27358162-27358275,27358968-27359024,27359102-273592...    29   6.5  
02_01_0507 - 3682383-3682703,3682830-3682970,3683071-3683147,368...    28   8.5  

>09_06_0015 -
           20234231-20234344,20234846-20234902,20234968-20235111,
           20235581-20235745,20235817-20236005,20236086-20236326,
           20236412-20236512,20236704-20237241,20238101-20238132,
           20238677-20238760
          Length = 554

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSL 442
           D  K+     +++L+++++   RE   A++K K EEE   K+    +E +  L  +  SL
Sbjct: 406 DQEKELKALQEAELRRLEETAARE--AALEKQKQEEEERRKKQLEEEELESSLASKQASL 463

Query: 443 P 445
           P
Sbjct: 464 P 464


>01_04_0038 -
           15339047-15339230,15339683-15339741,15340031-15340160,
           15340248-15340498,15340632-15341225,15342050-15342511
          Length = 559

 Score = 32.7 bits (71), Expect = 0.40
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = +1

Query: 511 WVHRLRRQGK-SLAFLTLRDGT--GYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVP 681
           WV   R QGK + AFL L DG+    LQ ++   +     A + +T +SV++ G+L+  P
Sbjct: 48  WVKTGREQGKGTFAFLELNDGSCASNLQVLVDAAVHPL--APLTATGTSVLVEGELKKPP 105

Query: 682 EGKK 693
           EG K
Sbjct: 106 EGAK 109


>02_01_0316 +
           2125283-2125687,2125768-2125881,2125986-2126099,
           2126271-2126561,2126658-2126768,2127317-2127370,
           2127555-2127634,2127912-2128027,2128141-2128382
          Length = 508

 Score = 32.3 bits (70), Expect = 0.52
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +1

Query: 517 HRLRRQGKSLAFLTLRDGTGYLQCVLHG 600
           H +R  G+ +AFL LR G+  +QCV+ G
Sbjct: 64  HAVRAVGRRVAFLVLRQGSSTVQCVVGG 91


>06_03_1108 -
           27661916-27662812,27662889-27663529,27663613-27664592,
           27664854-27664934,27668582-27668634,27669294-27669308,
           27670069-27670296
          Length = 964

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 13/54 (24%), Positives = 25/54 (46%)
 Frame = -1

Query: 236 WLFASMMHCFQYCLEWFLFRTITCIVIAILIRGIYLGQAKVSNVRHVERLLTNY 75
           W F  +  CF   L++FL       ++A ++ G +  +    NV  +E ++  Y
Sbjct: 344 WSFGKLALCFALLLQFFLLDLAAADIVAFVVAGFHQCRYGYKNVADLEGVVAGY 397


>10_08_0190 +
           15607241-15607409,15607932-15607990,15608883-15608991,
           15609394-15609551,15609976-15610044,15610158-15610847,
           15611112-15611629,15611725-15611789,15613010-15613089,
           15613894-15613998,15614768-15614881,15615029-15615168,
           15615257-15615385,15615903-15616055,15616186-15616327
          Length = 899

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%)
 Frame = +3

Query: 573 WVPTVRSTWFTMSDLQCSSPIYGVIC-GLVWKIRGCARGKEGSGWS 707
           W   + +   T  +   S+P+    C  L W++ GC  GK G+  S
Sbjct: 366 WYIAIETVNITQMNSTASTPLLDTTCFSLEWQVTGCLNGKAGTNCS 411


>12_01_0193 + 1436165-1437247
          Length = 360

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = +2

Query: 329 RENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHR 487
           +E  KA  KA   E   ++   N D A+ IL +   S+P +TV K C  T+ R
Sbjct: 43  QEKEKARQKAIRAE--IKRFRANQDAAEAILRKRKASMPPSTVTKFCTDTDLR 93


>10_02_0053 + 4607915-4608635,4609422-4609681,4609984-4610028
          Length = 341

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -1

Query: 467 IFSQQWPLVNLDPLAEESSLPHLSF 393
           IF+QQW L+NLD  A E  +  L F
Sbjct: 151 IFNQQWKLINLDLSANEKEVAMLDF 175


>05_05_0348 +
           24271764-24271898,24273055-24273144,24273205-24273303,
           24273725-24273826,24273912-24274088,24274193-24274398,
           24274491-24274575,24274641-24274798,24274873-24274948,
           24275117-24275245,24275313-24275457,24275561-24275691,
           24276183-24276335,24276447-24276636,24277006-24277139,
           24277248-24277406,24277659-24277964,24278040-24278216,
           24278446-24278529,24278592-24278822,24278913-24279002,
           24279090-24279211,24279293-24279448,24279477-24279635,
           24279705-24279765,24280004-24280138,24280384-24280471,
           24280548-24280620,24280883-24280994,24281691-24281711
          Length = 1327

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQK--IWVRENYKAM- 349
           ERE IQ + ++       ++ +     ++D ++   + K Q K+ ++  +  RE+ K + 
Sbjct: 350 EREKIQHSSQTLKE--MESVYNKHAKRQEDLENNMKSCKDQFKEFERKDVKYREDLKHLK 407

Query: 350 DKAKAEEENTEKRSQNLDEAKKILLQEDPSLPK 448
            K K  E+ TEK +  +DE+ K + +    +P+
Sbjct: 408 QKIKKLEDKTEKDTSKIDESTKEVEESSSLIPQ 440


>02_05_0226 +
           26971851-26972034,26972734-26972834,26972876-26972978,
           26973335-26973477,26973525-26973605,26973929-26974015,
           26974097-26974239,26974746-26974896,26974973-26975095,
           26975362-26975445,26975531-26975718,26976726-26976900,
           26977008-26977129,26977231-26977310,26977532-26977590,
           26977921-26978075,26978680-26978858,26980050-26980162,
           26980243-26980413,26980552-26980680,26980756-26980856,
           26980942-26981059,26981739-26981818,26983230-26983302,
           26983865-26983950,26984025-26984076,26984221-26984352,
           26984560-26984628,26984912-26985004,26985806-26985901,
           26986710-26986808,26986894-26986986,26987459-26987608,
           26988391-26988549
          Length = 1323

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 19/67 (28%), Positives = 32/67 (47%)
 Frame = +2

Query: 305 KKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEH 484
           K+ +K W   N +A+ +A  +    EK+    D+AK+ + +ED       + K  E  + 
Sbjct: 178 KERKKKWDEHNQEAISEALKQLNEFEKKHSKSDDAKQKMAREDLQSRLEYLRKQAEGYDD 237

Query: 485 RGQRICI 505
           RG  I I
Sbjct: 238 RGPVIDI 244


>04_03_0284 + 13896307-13896765
          Length = 152

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +1

Query: 697 PGGHELTADYWGIDWTR 747
           PGG  L+A +W I WTR
Sbjct: 135 PGGTSLSASFWRIGWTR 151


>03_02_1010 -
           13194002-13194339,13194421-13194573,13194661-13194809,
           13194932-13195184,13195282-13195469,13195684-13195841,
           13196093-13196307,13196410-13196614
          Length = 552

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 19/76 (25%), Positives = 30/76 (39%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSL 442
           DD +  D +AK   KK  K         +DK     +  E  ++   + KK  L+E+P  
Sbjct: 440 DDGEKVDASAKKSKKKKSKAEADGEAMDLDKPSNVADEAEPGTEKKKKKKKHKLEEEPQE 499

Query: 443 PKATVVKICETTEHRG 490
            + +V       E  G
Sbjct: 500 QEKSVAHANGDAEENG 515


>08_02_1473 -
           27358162-27358275,27358968-27359024,27359102-27359245,
           27359770-27359934,27360020-27360208,27360301-27360535,
           27360826-27360932,27361020-27361103,27361185-27361695,
           27361793-27361854,27363373-27363456
          Length = 583

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSL 442
           D  K+     +++L++++    RE   A+ K K EEE   ++    +E +  L  +  SL
Sbjct: 435 DREKELKAEQEAELRRLEAAAERE--AAIAKQKQEEEEKRRKQLEEEELESKLAAKQASL 492

Query: 443 PK 448
           PK
Sbjct: 493 PK 494


>02_01_0507 -
           3682383-3682703,3682830-3682970,3683071-3683147,
           3683835-3683901
          Length = 201

 Score = 28.3 bits (60), Expect = 8.5
 Identities = 9/17 (52%), Positives = 14/17 (82%)
 Frame = +1

Query: 487 WSEDMHQRWVHRLRRQG 537
           W E++H+R+VH +RR G
Sbjct: 3   WPEELHRRFVHAVRRLG 19


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,166,781
Number of Sequences: 37544
Number of extensions: 537420
Number of successful extensions: 1422
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1378
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1422
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2467979640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -