SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731...   184   1e-46
11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306...   182   4e-46
05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32...   182   4e-46
01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782...   182   4e-46
12_02_1282 + 27528159-27529148,27529549-27529614                      181   6e-46
03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137...   181   7e-46
01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054...   180   1e-45
10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910...   179   2e-45
12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323...   178   4e-45
05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585...   178   4e-45
08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981...    99   4e-21
08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160...    95   5e-20
02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980...    93   2e-19
08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207...    77   2e-14
04_03_0738 + 19169764-19169897,19169987-19170116,19170614-191706...    52   8e-07
01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931...    46   4e-05
01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238...    45   9e-05
04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182...    44   1e-04
07_03_0401 + 17724103-17724463,17724554-17724683,17725068-177250...    43   3e-04
07_03_0143 - 14315097-14315130,14315594-14315662,14316152-143162...    40   0.003
03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324...    34   0.13 
10_08_1042 - 22515298-22515354,22515614-22515709,22515806-225159...    33   0.29 
08_02_1454 - 27222004-27222296,27222389-27222500                       31   0.89 
03_06_0129 - 31883732-31883854,31883989-31884051,31884213-318842...    31   1.2  
07_03_1432 - 26508135-26508881,26509301-26509708                       31   1.5  
02_01_0351 - 2535305-2535627,2535707-2535842,2535942-2535977,253...    31   1.5  
07_03_0077 - 13128304-13128943,13129269-13129300                       30   2.0  
08_02_0135 - 13027496-13027933                                         30   2.7  
06_03_1146 - 28004896-28005554,28005664-28005844                       30   2.7  
04_03_0904 + 20717005-20718087                                         30   2.7  
04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527...    30   2.7  
03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093     30   2.7  
02_01_0190 + 1276808-1278214,1278450-1278743,1278815-1279087,127...    30   2.7  
11_06_0756 + 26952196-26952264,26952760-26953206,26954009-269553...    29   3.6  
09_04_0190 - 15443764-15443838,15445360-15445458,15446396-154468...    29   3.6  
09_02_0004 + 2895073-2896128,2896221-2896379                           29   4.7  
06_03_0178 + 17594062-17595576                                         29   4.7  
04_04_1125 + 31085106-31085714                                         29   4.7  
12_02_0823 + 23461423-23462124                                         29   6.2  
11_04_0097 + 13448740-13450725                                         29   6.2  
03_02_0708 + 10577931-10579511,10579613-10579706,10580694-105808...    29   6.2  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   6.2  
01_03_0308 - 14883728-14884120                                         29   6.2  
09_06_0184 - 21413275-21414267                                         28   8.3  
06_02_0152 - 12316242-12316248,12316634-12316800,12317689-123178...    28   8.3  
03_06_0331 - 33181757-33181795,33182325-33182453,33182941-331829...    28   8.3  
02_04_0107 - 19804730-19805044                                         28   8.3  

>03_05_0926 +
           28871800-28871859,28871943-28872336,28872586-28873199,
           28873281-28873346
          Length = 377

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNTPAMYVAIQAVLSL 144



 Score =  126 bits (304), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL Y+
Sbjct: 205 TAEREIVR-DMKEKLSYI 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>11_01_0403 +
           3059650-3059709,3059807-3060200,3060275-3060930,
           3060979-3061044
          Length = 391

 Score =  182 bits (442), Expect = 4e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  123 bits (297), Expect = 2e-28
 Identities = 63/78 (80%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 205 TAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>05_01_0047 -
           323097-323162,323287-323900,324233-324626,324718-324777
          Length = 377

 Score =  182 bits (442), Expect = 4e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  124 bits (298), Expect = 1e-28
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKL YV
Sbjct: 205 SAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>01_07_0285 -
           42476767-42476832,42476990-42477603,42477821-42478214,
           42478301-42478360
          Length = 377

 Score =  182 bits (442), Expect = 4e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  124 bits (298), Expect = 1e-28
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKL YV
Sbjct: 205 SAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>12_02_1282 + 27528159-27529148,27529549-27529614
          Length = 351

 Score =  181 bits (441), Expect = 6e-46
 Identities = 83/85 (97%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNAPAMYVAIQAVLSL 144



 Score =  126 bits (303), Expect = 3e-29
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL Y+
Sbjct: 205 TAEREIVR-DVKEKLSYI 221



 Score =  104 bits (249), Expect = 1e-22
 Identities = 46/59 (77%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   DDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>03_06_0585 -
           34912159-34912224,34912634-34913247,34913350-34913734,
           34913824-34913883
          Length = 374

 Score =  181 bits (440), Expect = 7e-46
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNAPAMYVAIQAVLSL 144



 Score =  109 bits (262), Expect = 3e-24
 Identities = 58/78 (74%), Positives = 61/78 (78%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGR   IVLDSGDGV+HTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGR---IVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTT 201

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL Y+
Sbjct: 202 TAEREIVR-DIKEKLAYI 218



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>01_06_1455 +
           37504175-37504231,37504357-37504750,37504865-37505478,
           37506021-37506086
          Length = 376

 Score =  180 bits (438), Expect = 1e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNCPAMYVAIQAVLSL 143



 Score =  120 bits (289), Expect = 1e-27
 Identities = 61/78 (78%), Positives = 63/78 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG+ LPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGFTLPHAILRLDLAGRDLTDNLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 204 TAEREIVR-DIKEKLAYV 220



 Score =  107 bits (257), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           M +E++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE +
Sbjct: 1   MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>10_08_0597 +
           19089616-19089675,19089789-19090182,19090451-19091064,
           19091160-19091225
          Length = 377

 Score =  179 bits (436), Expect = 2e-45
 Identities = 81/85 (95%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETF+ PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFSVPAMYVAIQAVLSL 144



 Score =  124 bits (298), Expect = 1e-28
 Identities = 63/78 (80%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKL YV
Sbjct: 205 SAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>12_01_0409 -
           3230853-3230918,3231372-3231994,3232454-3232847,
           3233000-3233059
          Length = 380

 Score =  178 bits (434), Expect = 4e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPALLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFE+FN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFESFNVPAMYVAIQAVLSL 144



 Score =  123 bits (297), Expect = 2e-28
 Identities = 63/78 (80%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 205 TAEREIVR-DIKEKLAYV 221



 Score =  105 bits (252), Expect = 4e-23
 Identities = 47/59 (79%), Positives = 53/59 (89%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE ++K
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63


>05_04_0450 -
           21356877-21356942,21357482-21358095,21358173-21358566,
           21358648-21358704
          Length = 376

 Score =  178 bits (434), Expect = 4e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ+KRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPE+HPVLLTEAPLNPKANRE
Sbjct: 59  AQAKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEDHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNCPAMYVAIQAVLSL 143



 Score =  121 bits (292), Expect = 6e-28
 Identities = 61/78 (78%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGY LPHAILRLD +   LTD+LMKILTERGYS  T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYTLPHAILRLDLAGRDLTDHLMKILTERGYSLTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A REI     KEKL YV
Sbjct: 204 SAEREIVR-DIKEKLAYV 220



 Score =  110 bits (264), Expect = 2e-24
 Identities = 49/62 (79%), Positives = 55/62 (88%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           M DE++  +V DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDE +
Sbjct: 1   MADEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQ 60

Query: 262 AK 267
           AK
Sbjct: 61  AK 62


>08_02_0441 -
           17196352-17196536,17196780-17196906,17198018-17198101,
           17198282-17198348,17198575-17198633,17199211-17199336,
           17199406-17199474,17199545-17199653,17199692-17199760,
           17199876-17199979,17200518-17200567,17200696-17200774,
           17200867-17200938,17201083-17201217,17201311-17201421,
           17202088-17202129
          Length = 495

 Score = 99.1 bits (236), Expect = 4e-21
 Identities = 42/78 (53%), Positives = 56/78 (71%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E +N   +++ +QAVLSL
Sbjct: 126 EKYNFAGVFIQVQAVLSL 143



 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H VP+ +G++ PH   R++ +   +T YL+ +L+ RGY+   
Sbjct: 144 YAQGLLTGLVIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHITSYLVDLLSRRGYAMNK 203

Query: 689 NAXRE-IRS*TFKEKLCYV 742
           +A  E +R    KEKLCY+
Sbjct: 204 SADFETVRE--IKEKLCYL 220



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>08_01_0194 -
           1603702-1603782,1603970-1604062,1604203-1604328,
           1604403-1604513,1604989-1605108,1605665-1605757,
           1606024-1606157,1606503-1606530,1606821-1607075,
           1607167-1607401,1608147-1608193
          Length = 440

 Score = 95.5 bits (227), Expect = 5e-20
 Identities = 40/81 (49%), Positives = 57/81 (70%)
 Frame = +3

Query: 270 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 449
           G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +I
Sbjct: 82  GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEI 141

Query: 450 MFETFNTPAMYVAIQAVLSLT 512
           MFETFN P +Y+++Q+VLSL+
Sbjct: 142 MFETFNVPGLYISVQSVLSLS 162



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 28/79 (35%), Positives = 42/79 (53%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG+V+D GDG  H VP+  GY +  +I    FS S +T +++++L ERG         +I
Sbjct: 188 TGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPEDSLDI 247

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE  CY  S + K+
Sbjct: 248 AR-RVKEMYCYTSSDIVKE 265



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           A+V+DNG+G  K GF+G+  P    P++V
Sbjct: 8   AVVIDNGTGYSKLGFSGNSEPCFTIPTVV 36


>02_04_0473 +
           23197294-23197340,23197443-23197680,23197792-23198016,
           23198616-23198762,23198827-23198961,23199415-23199507,
           23199925-23200044,23200303-23200413,23200486-23200611,
           23200731-23200829,23201024-23201104
          Length = 473

 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 41/76 (53%), Positives = 50/76 (65%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           L YPI +G V NWD ME+ W    +N LR  PE+H  LLTE+PL P   RE   +IMFET
Sbjct: 87  LSYPIHNGQVENWDTMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPETREYTGEIMFET 146

Query: 462 FNTPAMYVAIQAVLSL 509
           FN P +Y+A Q VL+L
Sbjct: 147 FNVPGLYIACQPVLAL 162



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           TG+V+D GDG +H VP+ +GY +  +I  +  +   +T ++ ++L
Sbjct: 174 TGVVVDVGDGATHIVPVADGYVIGSSIRSIPITGKDVTQFIQQLL 218



 Score = 34.7 bits (76), Expect = 0.095
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AVVIDNGTGYTKMGFAGNVEPCFITPTVV 36


>08_01_0254 +
           2078380-2078392,2078487-2078578,2079579-2079698,
           2079924-2080097,2080184-2080257,2080847-2080927,
           2081306-2081366,2081437-2081486,2082278-2082332,
           2082599-2082676,2082757-2082810,2083703-2083756,
           2083846-2083906,2084229-2084280,2085118-2085184,
           2085393-2085452,2085546-2085608,2085752-2085814,
           2086337-2086401,2086620-2086688,2086742-2086847
          Length = 503

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 31/72 (43%), Positives = 47/72 (65%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 137 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 196

Query: 471 PAMYVAIQAVLS 506
           PA+++A  AVL+
Sbjct: 197 PALFLAKNAVLT 208



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 186
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           ++ASGR T +V+DSG G +    +++GY L  ++         LTD +MK L  +G
Sbjct: 209 SFASGRATSLVVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKG 264


>04_03_0738 +
           19169764-19169897,19169987-19170116,19170614-19170687,
           19171208-19171288,19172054-19172087
          Length = 150

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           P++ G   +WD ++ IW+H F   L + PEEHP+L+ E   N    REK
Sbjct: 92  PMKDGTFIDWDIVDNIWNHAFRQRLLINPEEHPMLIVEPSTNTGQQREK 140


>01_01_1170 -
           9318332-9318461,9318551-9318613,9318694-9318744,
           9318837-9318921,9319005-9319068,9319139-9319340,
           9319808-9320502
          Length = 429

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           +TL+ PI+ G + N +   ++W     N L+V P    +LL E   NP A +    +++F
Sbjct: 60  MTLRRPIDRGYLINQEVQREVWERVIRNLLQVDPNNSSLLLVEPQFNPPALQHATDELVF 119

Query: 456 ETFNTPAMYVA 488
           E     ++ VA
Sbjct: 120 EELGFKSLCVA 130



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 31/115 (26%), Positives = 52/115 (45%)
 Frame = +2

Query: 458 NIQHARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRL 637
           ++ H     R PS   A  S     +V+D G   +H  P+ + + L +A+ R+D     L
Sbjct: 134 SLVHLYEASRQPSLFRAQCS-----LVVDCGFSFTHASPVLQNFTLNYAVRRMDLGGKAL 188

Query: 638 TDYLMKILTERGYSFITNAXREIRS*TFKEKLCYVGS*LSKQXIGXRLHSKXFPF 802
           T+YL ++++ R  + +      +     KEKLC+V   +       RL S   PF
Sbjct: 189 TNYLKELISYRSLNVMDET---LLIDDAKEKLCFVSLDVPGDLRLARLSSNDNPF 240



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V+DNG G+ KAGF GD  P AV P+ + +P
Sbjct: 8   VVLDNGGGLLKAGFGGDMNPTAVVPNCMAKP 38


>01_01_0292 -
           2387653-2387711,2388061-2388684,2388814-2389104,
           2389338-2389390,2390496-2390968,2391090-2391432,
           2391793-2391911,2392081-2392512,2392657-2392747,
           2392833-2392942,2393681-2393875,2394581-2394622,
           2395144-2395268,2395856-2395926,2396047-2396147
          Length = 1042

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           ++ P +  +V  ++ ME I    F      +   HP+L+TE   NP  +R +M++++FET
Sbjct: 82  IRSPFDDDVVYQFEYMEYILDFGFDRLGATSEVGHPILMTECECNPSFSRARMSELLFET 141

Query: 462 FNTPAM 479
           +  P++
Sbjct: 142 YGVPSI 147



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           +V+DNG+   + G+AG+  PR  F +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASTFRIGWAGEAEPRVAFRNIVQRPRHR----SSGETVTVVGD 66


>04_04_1515 +
           34117383-34117732,34117833-34117918,34118227-34118297,
           34118457-34118524,34118692-34118753,34119010-34119107,
           34119545-34119626,34119935-34120077,34120233-34120381,
           34120461-34120594,34120714-34120832,34120926-34121014,
           34121398-34121515
          Length = 522

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDFSRSRLTDYLMKILTERGYSFI 685
           YA+ RT+GIV++ G   +  VPI++G  +    +  +     +LT +L +++ +R  +F 
Sbjct: 251 YAAKRTSGIVVNIGFNATSIVPIFQGRVMHEIGVETVGQGALKLTGFLKELMQQRNITF- 309

Query: 686 TNAXREIRS*TFKEKLCYVGS 748
             +   +R  T KEKLCYV +
Sbjct: 310 -ESLYTVR--TIKEKLCYVAA 327


>07_03_0401 +
           17724103-17724463,17724554-17724683,17725068-17725083,
           17725130-17725203,17725693-17725761,17726224-17726257
          Length = 227

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +3

Query: 261 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           ++R  + +  P++ G   +WD ++ IW+H F       PEEHP+L+ E   N    REK
Sbjct: 163 NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYPEEHPMLIVEPSTNTGQQREK 217


>07_03_0143 -
           14315097-14315130,14315594-14315662,14316152-14316225,
           14316316-14316331,14316716-14316845,14316936-14316999
          Length = 128

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +3

Query: 261 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           ++R  + +  P++ G   +WD ++ IW+H F        EEHP+L+ E   N    REK
Sbjct: 64  NRRDHMEVISPMKDGTFIDWDIVDNIWNHAF----SFYAEEHPMLIVEPSTNTGQQREK 118


>03_06_0192 +
           32230953-32231030,32231130-32231485,32232250-32232425,
           32233857-32234038,32234260-32234443,32235192-32235259,
           32235343-32235495
          Length = 398

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 16/30 (53%), Positives = 21/30 (70%)
 Frame = +3

Query: 420 KANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           +A RE++ Q+MFE FN    Y + QAVLSL
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSL 185


>10_08_1042 -
           22515298-22515354,22515614-22515709,22515806-22515988,
           22516277-22516365,22516481-22516722,22517008-22518116
          Length = 591

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 1/85 (1%)
 Frame = +1

Query: 601 RHPASGL*PVATHRLPHEDSHRARLLVHYQRRXGNSFVNIQGEAVLRRLLTFEAGDWPXV 780
           +HPA      +  R   ++ H+A++  H++ +   S+ N    A+ +R+L  + G+W   
Sbjct: 41  KHPADN----SVVRFYVDEGHKAKIKCHFKMQIIQSYQNFMTSALPKRILLRQGGEWKDF 96

Query: 781 AFQXVSFRRKFLRXFPGTVQG-HST 852
             Q V       R      +G H T
Sbjct: 97  PKQIVKLAHSDFRTKKTITEGEHQT 121


>08_02_1454 - 27222004-27222296,27222389-27222500
          Length = 134

 Score = 31.5 bits (68), Expect = 0.89
 Identities = 22/65 (33%), Positives = 29/65 (44%)
 Frame = +1

Query: 541 GLRRRCLPHRAHLRGIRTPPRHPASGL*PVATHRLPHEDSHRARLLVHYQRRXGNSFVNI 720
           G+ R     RA   G+R PPR     L P A H LP   S  A++L       G    ++
Sbjct: 66  GMTRLRRWERAAAMGLRPPPRLRDLLLPPPAPHPLPSSSSSPAKILT--GSSGGGGSTSV 123

Query: 721 QGEAV 735
           QGE +
Sbjct: 124 QGECL 128


>03_06_0129 -
           31883732-31883854,31883989-31884051,31884213-31884272,
           31884724-31884784,31884934-31885004,31885313-31885389,
           31885856-31885913,31885995-31886048,31886279-31886297,
           31886359-31886466,31886574-31886690,31886836-31886919,
           31887079-31887171,31887279-31887499,31888294-31888371,
           31889237-31889499,31890109-31890247
          Length = 562

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = -2

Query: 642 SVSRDRLKSRRRMAWGSAYPS*MGTVWETPSPESSTIPV 526
           S S  R  S  RM  G+  P+  G +W TPS E  TI V
Sbjct: 41  SASGPRGCSAVRMETGAVEPASTGAIWSTPSVEPRTISV 79


>07_03_1432 - 26508135-26508881,26509301-26509708
          Length = 384

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVPPVSCWTP--ATVSPTPCPSTRDTHSPTP 605
           TP  Y +  ++   T P  PP S   P  A VSP+P P+T    SPTP
Sbjct: 30  TPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSP-PTTYLPPSPTP 76


>02_01_0351 -
           2535305-2535627,2535707-2535842,2535942-2535977,
           2536057-2536173
          Length = 203

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +1

Query: 457 KHSTRPPCTSPSKPCSRLRVRSYHRYRAGLRRRCLPHRAHLRGIRTP 597
           +H   PP T P++    + +R     R  +R R  P R  L G R P
Sbjct: 135 QHDEPPPITQPAQDYDDVDLRGVEVVRRSVRERYSPERLSLSGRRPP 181


>07_03_0077 - 13128304-13128943,13129269-13129300
          Length = 223

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +1

Query: 535 RAGLRR-RCLPHRAHLRGIRTPPRHPASG 618
           RAGL   R + HRA +R  R P RHP SG
Sbjct: 77  RAGLLPVRGVDHRARVRAPRAPRRHPRSG 105


>08_02_0135 - 13027496-13027933
          Length = 145

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +3

Query: 411 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPA 551
           ++ K  R   ++I+F  F TP M ++     SLTRP     + W P+
Sbjct: 6   VDAKHARRIFSEIIFPRFGTPRMVISDGDRTSLTRPSENSYARWVPS 52


>06_03_1146 - 28004896-28005554,28005664-28005844
          Length = 279

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTPATVSPTPCPS-TRDTHSPTPSCVWTLAGRDSQTTS*RFSPSA 671
           A + +  P   P S   PA  +P+  PS    T SP+PS V  +A   + TTS   SP A
Sbjct: 153 APVPMPSPASSPPSP-APAAATPSLAPSPVATTPSPSPS-VSPMAPAPAPTTSTPSSPPA 210

Query: 672 ATRSLPTP 695
                P+P
Sbjct: 211 PAAMAPSP 218


>04_03_0904 + 20717005-20718087
          Length = 360

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 24/79 (30%), Positives = 30/79 (37%), Gaps = 3/79 (3%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPST-RDTHSPTPSCVWTLAGRDSQT 644
           TP  Y         T P   P    TPA  +PTP P T +    PTP   +    + + T
Sbjct: 108 TPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPKPTPPPTYKPQPKPTPT 167

Query: 645 --TS*RFSPSAATRSLPTP 695
             T     PS   +  PTP
Sbjct: 168 PYTPTPTPPSYKPQPKPTP 186


>04_03_0747 -
           19251617-19251781,19252377-19252502,19252606-19252716,
           19252931-19253679,19254034-19254167,19254595-19254740,
           19255166-19255336,19255977-19256828
          Length = 817

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 1/115 (0%)
 Frame = +3

Query: 360 ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSC 539
           E  V  EE  V++ E   + +   E++ +I     ++P     + A   ++ P  PP   
Sbjct: 84  EAEVVVEEEEVVVVE---DEEEEYEEVEEIEDPDGDSPF----VDAPEHISPPPPPPPPA 136

Query: 540 WTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATR-SLPTPXG 701
            TP   +PTP P+   T  P P     L  R    T     PSA  R + P+P G
Sbjct: 137 RTPMP-TPTPTPTPTPTRPPVPVWAAPLPARTPTPT-----PSAPPRAAAPSPAG 185


>03_05_0735 - 27247767-27248285,27249030-27249318,27250594-27251093
          Length = 435

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = -1

Query: 304 PCSMGYLRVRIPLLLCAHLLHKSPSVPYRPSRPDGGAFPR 185
           PCS  +      L+LC +   + P+V +RP+ PDGGA P+
Sbjct: 192 PCSRSH-----DLILC-NSQSRCPTVQHRPTPPDGGAPPK 225


>02_01_0190 +
           1276808-1278214,1278450-1278743,1278815-1279087,
           1279204-1279336,1279425-1279551,1279788-1280284,
           1280578-1280642,1280722-1280823,1281020-1281162,
           1281761-1281816,1282214-1282869,1282975-1283165,
           1283280-1283574,1283738-1283778,1284082-1284104,
           1284173-1284369,1284472-1284581,1285309-1285639,
           1285968-1286060,1286095-1286166,1286626-1286886
          Length = 1788

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = +3

Query: 558 SPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHSRRSCA 737
           SP+P PS R + S +PS   TL+   S+T S   + S++++ LP+   + VR   +   A
Sbjct: 89  SPSPSPSPRRSTSASPSA--TLSSLVSRTFSNNAASSSSSKPLPS-LFRGVRPSPKPGAA 145

Query: 738 TSALDFRSR 764
            +A    SR
Sbjct: 146 LAAAAAASR 154


>11_06_0756 +
           26952196-26952264,26952760-26953206,26954009-26955358,
           26955400-26955408
          Length = 624

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 14/44 (31%), Positives = 19/44 (43%)
 Frame = +3

Query: 462 FNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTH 593
           F TPAM + ++    L  P  PP +    A   P+ C    D H
Sbjct: 525 FMTPAMVIIVEEARKLPPPPPPPPAAAEAARERPSGCDGGDDIH 568


>09_04_0190 -
           15443764-15443838,15445360-15445458,15446396-15446891,
           15449436-15449479,15449999-15450104,15450243-15450314,
           15450474-15450588,15451182-15451407
          Length = 410

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 14/29 (48%), Positives = 14/29 (48%)
 Frame = +1

Query: 562 PHRAHLRGIRTPPRHPASGL*PVATHRLP 648
           P R     I TPPRHP   L P A  R P
Sbjct: 194 PSRRRRSAIATPPRHPRRRLAPHANRRRP 222


>09_02_0004 + 2895073-2896128,2896221-2896379
          Length = 404

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 2/75 (2%)
 Frame = -1

Query: 664 GENLHEVVCESRPAKVQTQDGVGECVSLVDG-HGVGDTVAG-VQHDTGGTTGRVSESTAW 491
           G  LH +  ES+P +   + G    ++   G     D V G +Q+D    T  ++++  W
Sbjct: 314 GPKLHAIASESQPGQAPVRTGGMRLMTSTGGTTNPPDQVTGEIQYD---LTEHIAQTQEW 370

Query: 490 MATYMAGVLNVSNMI 446
             +  A   N++NM+
Sbjct: 371 QQSADAQFTNINNMM 385


>06_03_0178 + 17594062-17595576
          Length = 504

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 543 TPATVSPTPCPSTRDTHSPTPS 608
           +P  +SP+P PST    SPTPS
Sbjct: 8   SPRHLSPSPAPSTPRPSSPTPS 29


>04_04_1125 + 31085106-31085714
          Length = 202

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPST--RDTHSPTPS 608
           P  P  + WTP   +P P P+T    T  PTP+
Sbjct: 70  PTPPTPTPWTPTPATPPPTPATPATPTTPPTPA 102


>12_02_0823 + 23461423-23462124
          Length = 233

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%)
 Frame = -3

Query: 272 TSFALCSSPT*ESFCPIPT---ITP*WRGLPTIEGNTAR 165
           TS A  +  T  + CP P    +TP   G P+I GNTAR
Sbjct: 19  TSVAAATKLTLHNLCPYPVWPLVTPN-TGFPSISGNTAR 56


>11_04_0097 + 13448740-13450725
          Length = 661

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +3

Query: 489 IQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           +  +L L  P+ P +     AT +PTP P+  D    TP+
Sbjct: 8   LSRLLPLPLPLRPHLRLLCLATATPTPAPTPADADQATPT 47


>03_02_0708 +
           10577931-10579511,10579613-10579706,10580694-10580856,
           10581286-10581491,10581854-10582062
          Length = 750

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 720 SRRSCATSALDFRSRXLAXGCIPXSFLSKKVLTXXSRNGSRSF 848
           +R SC   A++  S+ +  G +P  F    VL+  ++ G+R +
Sbjct: 162 ARNSCLKDAMNIFSKLVNSGLVPDGFSFSSVLSACAQAGARCY 204


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -3

Query: 203 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 84
           WR  P +  + ARG S P + AL   +P++     +++ H
Sbjct: 251 WRRTPWVGAHAARGGSRPLRRALQGLDPVTIAAIFSTAEH 290


>01_03_0308 - 14883728-14884120
          Length = 130

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 20/67 (29%), Positives = 26/67 (38%)
 Frame = +3

Query: 543 TPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHS 722
           T AT  P+P P    T S +P    + +  D QTT        A         +  R H 
Sbjct: 30  TGATALPSPSPIENSTASRSPFPTTSPSMIDEQTTERAPEIGGAVAGRKPSLAELWRRHR 89

Query: 723 RRSCATS 743
           R SC +S
Sbjct: 90  RCSCNSS 96


>09_06_0184 - 21413275-21414267
          Length = 330

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 16/64 (25%), Positives = 27/64 (42%)
 Frame = +3

Query: 417 PKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHS 596
           P ++    ++        PA+  ++++     RP   P S   P+  SP P PS R    
Sbjct: 64  PASSLSSCSETAVSFLPAPALPTSMESTFPSPRPPSTPSSSTPPS--SPVPPPSARSPTV 121

Query: 597 PTPS 608
           P P+
Sbjct: 122 PAPA 125


>06_02_0152 -
           12316242-12316248,12316634-12316800,12317689-12317800,
           12317930-12317999,12318535-12318535,12318791-12319144
          Length = 236

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 7/71 (9%)
 Frame = +3

Query: 501 LSLTRPVVPPVSCWTPATVS--PTPC----PSTRDTHSPTPSCVW-TLAGRDSQTTS*RF 659
           LS  RP  P     TP + S  PTP     P T    +PTP  VW T+A  D+ +   R 
Sbjct: 32  LSSFRP--PATDAATPGSDSSYPTPTSIPPPPTSLPSTPTPVAVWRTVASVDNASPPSRL 89

Query: 660 SPSAATRSLPT 692
                T  +PT
Sbjct: 90  RSGTPTALMPT 100


>03_06_0331 -
           33181757-33181795,33182325-33182453,33182941-33182967,
           33183459-33183545,33183827-33183975,33185467-33185521,
           33185596-33187584,33188705-33188782
          Length = 850

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +2

Query: 410 PQPQGQQREDDPDHVRNIQH 469
           P    Q+  DDPDHV+N+ H
Sbjct: 393 PHETNQEDLDDPDHVKNLLH 412


>02_04_0107 - 19804730-19805044
          Length = 104

 Score = 28.3 bits (60), Expect = 8.3
 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 11/78 (14%)
 Frame = +1

Query: 469 RPPCTSPSKP-------CSRLRVRSYHRYRAGLRRRCLPHRA-HLRGIRTPPRHPASGL* 624
           +PP   P +P       C+R R   +H+ R G RRRC   RA  +       R     + 
Sbjct: 19  QPPLAPPLRPTAEATVICNRGRQGRHHQGRRGHRRRCQGRRAPSIAASHLVRRRRLVTVK 78

Query: 625 PVATHR---LPHEDSHRA 669
           P A  R   LP    HRA
Sbjct: 79  PAAASRSGSLPASPHHRA 96


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,082,907
Number of Sequences: 37544
Number of extensions: 672085
Number of successful extensions: 2690
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 2399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2667
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2385713652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -