SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0204 + 1642169-1642687                                           32   0.53 
07_03_1523 + 27432991-27433199,27433585-27434185,27434468-274346...    31   1.2  
04_01_0137 - 1549562-1550213,1553363-1553896,1554524-1554606           30   2.1  
05_07_0162 + 28090579-28091343                                         29   3.7  
03_01_0470 + 3619417-3619572,3619681-3619759,3620017-3620258,362...    29   3.7  
06_03_1365 + 29598130-29598523,29599016-29599078,29599292-29599398     29   6.5  
06_01_0267 - 1972988-1973148,1973275-1973403,1973881-1974024,197...    29   6.5  
04_03_0716 + 18995712-18995904,18996511-18996614,18997280-189973...    29   6.5  

>08_01_0204 + 1642169-1642687
          Length = 172

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = -1

Query: 714 NGDLLIXELCKQMSIVIQIITKDATCANIY*LK 616
           NGD      C+Q S+V++++T DA  + +Y LK
Sbjct: 56  NGDSAAEAACRQPSVVLELMTADAAASVVYELK 88


>07_03_1523 +
           27432991-27433199,27433585-27434185,27434468-27434642,
           27434686-27436418,27436871-27437317
          Length = 1054

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 22/67 (32%), Positives = 26/67 (38%), Gaps = 1/67 (1%)
 Frame = -3

Query: 439 PNL*RRNTLLSRHETASSSHRVANVXP-VPAASKAHTGPAGGATHRPAHSGGGTPSRTLA 263
           PNL     L   H  AS S  VA       AA     G  G + HRP       P   LA
Sbjct: 121 PNLADARGLQRYHRQASQSAAVATTCSRCVAADATGCGSLGASRHRPWRPRAAAPRSALA 180

Query: 262 RTSHPGL 242
           R++  G+
Sbjct: 181 RSTFRGV 187


>04_01_0137 - 1549562-1550213,1553363-1553896,1554524-1554606
          Length = 422

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +2

Query: 569 NGKNLFVFYVILGINNFNQYIFAHVASFVIIWMT 670
           N K LF+ Y ++   N N Y++   ++ V+ W T
Sbjct: 172 NNKELFLVYELMKNGNLNDYLYKSESAAVLSWQT 205


>05_07_0162 + 28090579-28091343
          Length = 254

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 11/16 (68%), Positives = 11/16 (68%)
 Frame = +3

Query: 288 PPLCAGRCVAPPAGPV 335
           PPL  GRCV PP  PV
Sbjct: 52  PPLAGGRCVGPPLYPV 67


>03_01_0470 +
           3619417-3619572,3619681-3619759,3620017-3620258,
           3620804-3621148,3623592-3624116
          Length = 448

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/26 (50%), Positives = 14/26 (53%)
 Frame = -1

Query: 315 PRTALHTAAAAPPRGPSLGPVTRGSH 238
           P  ALHT  AAPP     GP   G+H
Sbjct: 130 PSPALHTRTAAPPSHCRPGPAPSGAH 155


>06_03_1365 + 29598130-29598523,29599016-29599078,29599292-29599398
          Length = 187

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = -3

Query: 409 SRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTS 254
           S   TA+++   A      AAS A TG A     +P  SGG T   +L   S
Sbjct: 121 SSSATAAAAAAGAGTAGSTAASSASTGNAASTAAKPTASGGATHRLSLISAS 172


>06_01_0267 -
           1972988-1973148,1973275-1973403,1973881-1974024,
           1974368-1974493,1974595-1974720,1975149-1975241,
           1975465-1975606,1976747-1976878,1976943-1977080,
           1977431-1977523,1978186-1978389,1978568-1978656,
           1978839-1978988,1979088-1979253,1979355-1979576,
           1979687-1979872,1980289-1980411,1980511-1980611,
           1982005-1982155
          Length = 891

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -3

Query: 385 SHRVANVXPVPAASKAHTGPAGGATHRPAHSG 290
           S +VAN  P  AA K     AGG  +R   SG
Sbjct: 2   SGKVANATPKAAAGKPRLSAAGGGAYRRTSSG 33


>04_03_0716 +
           18995712-18995904,18996511-18996614,18997280-18997393,
           18997819-18997824,18998041-18998097
          Length = 157

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 16/37 (43%), Positives = 19/37 (51%)
 Frame = -1

Query: 339 RILVLPAGPRTALHTAAAAPPRGPSLGPVTRGSHIRC 229
           R L++P  PR A   AAAA P      P  R  H+RC
Sbjct: 10  RSLLVPDHPRAA--AAAAARPAAGRRAPRRRSRHLRC 44


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,024,728
Number of Sequences: 37544
Number of extensions: 517533
Number of successful extensions: 1837
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1735
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1829
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2491484208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -