SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0094 - 25758213-25758479,25758886-25758975,25759090-257591...    30   2.0  
03_02_0454 + 8626832-8627134,8627255-8627606,8627705-8627748,862...    29   2.6  
07_03_1479 - 26832976-26833095,26833737-26833943,26834104-268342...    28   6.1  
07_01_0346 - 2501825-2501908,2502143-2502244,2502623-2502646,250...    28   6.1  
03_05_0892 + 28563151-28563669,28563977-28564035,28564170-285642...    28   6.1  
03_02_0476 + 8768182-8768313,8768734-8768833,8768949-8768986,876...    28   6.1  
05_05_0204 + 23241555-23241696,23241770-23242910,23243058-23243583     28   8.0  

>02_05_0094 -
           25758213-25758479,25758886-25758975,25759090-25759118,
           25759208-25759307,25759411-25759545
          Length = 206

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 11/54 (20%), Positives = 25/54 (46%)
 Frame = +1

Query: 331 GNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKC 492
           G   E  + G +    +S  +  +  C+ C + +    K+ ++ +++H  C KC
Sbjct: 80  GKSSEKSDQGRAPSKLSSAFSGTQDKCAACQKTVYPLEKLTLEGESYHKSCFKC 133


>03_02_0454 +
           8626832-8627134,8627255-8627606,8627705-8627748,
           8629014-8629035,8629136-8629350,8629468-8629592,
           8629681-8629756
          Length = 378

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +3

Query: 603 EFFKQCFEQFADPRFAENMKQFM 671
           EFFK+C+   A P  AE  K F+
Sbjct: 149 EFFKKCYSDIAGPEHAEKWKTFI 171


>07_03_1479 - 26832976-26833095,26833737-26833943,26834104-26834252,
            26834330-26834732,26834840-26835118,26835285-26835716,
            26836362-26836838,26837171-26837212,26837285-26837545,
            26837637-26838938,26839146-26839575,26839643-26840046,
            26840360-26840716,26840842-26841102,26841494-26842141,
            26842231-26842452,26842547-26842768,26842860-26843009,
            26843739-26844111,26844467-26844689,26845167-26845425,
            26845585-26845920,26846013-26846999,26848395-26849624,
            26849706-26849768,26849858-26849910,26849998-26850079,
            26850520-26850588,26851070-26851129,26851205-26851267,
            26851993-26852101,26852742-26852827,26853120-26853847,
            26854613-26854676
          Length = 3716

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +3

Query: 549  CEPCFQHHVLHRHKDNPNEFFKQCFEQFADPRFA 650
            C  CF    +++H D   E +KQ FE+  DP  A
Sbjct: 3239 CRACFSQDAVNKHVDFVKE-YKQDFERDLDPESA 3271


>07_01_0346 -
           2501825-2501908,2502143-2502244,2502623-2502646,
           2502693-2502819,2503122-2505109,2505804-2505821
          Length = 780

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +1

Query: 289 SVHTNWAQWTCG---KFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENN 444
           S H ++  W+ G   KF   + G+    SS  E     T++SVC R  ++I+E +
Sbjct: 269 SKHEHFGNWSSGWKHKFFGKKSGEERTPSSNEENISSATQKSVCPR--EVISEKS 321


>03_05_0892 +
           28563151-28563669,28563977-28564035,28564170-28564295,
           28564460-28564595,28564901-28565209
          Length = 382

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/50 (32%), Positives = 22/50 (44%)
 Frame = +3

Query: 495 FLPHGPSSNIHICYGQVFCEPCFQHHVLHRHKDNPNEFFKQCFEQFADPR 644
           FLP  P+   HI +G +FC PC    +  R      E  K   + +A  R
Sbjct: 176 FLPRTPAPLQHI-FGSIFCLPCLLCFICMRDTFVSEEKLKDASKLYAPGR 224


>03_02_0476 +
           8768182-8768313,8768734-8768833,8768949-8768986,
           8769102-8769191,8769465-8769695
          Length = 196

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 11/43 (25%), Positives = 21/43 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAM 537
           C+ C +      K+ ++ QA+H  C KC        P++ +A+
Sbjct: 108 CATCSKTAYPLEKVTVEGQAYHKSCFKCSHGGCAISPSNYAAL 150


>05_05_0204 + 23241555-23241696,23241770-23242910,23243058-23243583
          Length = 602

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/44 (29%), Positives = 19/44 (43%)
 Frame = -2

Query: 220 EHLHRRRNCSADATRAANSMKALPCYFNGVFRIHR*KTSSTKWL 89
           E  H R  CS  AT  A ++  +PC +     I    + +  WL
Sbjct: 8   ETTHNRAYCSEAATAIAVAVAVVPCIYRRATEISHKYSGAAHWL 51


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,622,010
Number of Sequences: 37544
Number of extensions: 420512
Number of successful extensions: 1272
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1230
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1271
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1756684372
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -