SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1272 - 25360180-25360286,25360454-25360658,25360748-253609...   114   4e-26
03_01_0582 - 4318837-4318967,4319219-4319399,4319504-4319701,431...   114   4e-26
05_07_0129 - 27886738-27886767,27887043-27887312,27888407-278884...    28   3.4  
05_01_0127 - 863755-865182                                             27   6.0  
10_08_0492 + 18292208-18292248,18292874-18293365,18294139-182943...    27   7.9  
06_03_0424 - 20648938-20649564,20650588-20650902                       27   7.9  
05_03_0609 - 16161801-16162848,16163525-16163682,16163806-161638...    27   7.9  
04_04_1331 - 32706043-32707248,32707411-32707652,32707737-327085...    27   7.9  

>07_03_1272 -
           25360180-25360286,25360454-25360658,25360748-25360945,
           25361034-25361296,25361865-25362009
          Length = 305

 Score =  114 bits (274), Expect = 4e-26
 Identities = 54/82 (65%), Positives = 64/82 (78%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAAR +VAIENP D+ V S+R +GQRAVLKFA +TGA  IAGR TPG FTNQ+Q +F
Sbjct: 61  KLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSF 120

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E++
Sbjct: 121 SEPRLLILTDPRTDHQPIKESA 142



 Score = 81.4 bits (192), Expect = 3e-16
 Identities = 35/75 (46%), Positives = 46/75 (61%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TDSP+ +VDI IP N K   SIG ++W                  WDV+VDL
Sbjct: 146 IPTIAFCDTDSPMRYVDIGIPANNKGKQSIGCLFWLLARMVLQMRGTILPGHKWDVMVDL 205

Query: 437 FFYRDPEESEKDEQQ 481
           FFYRDPEE+++ E++
Sbjct: 206 FFYRDPEEAKEQEEE 220


>03_01_0582 -
           4318837-4318967,4319219-4319399,4319504-4319701,
           4319791-4320053,4320453-4320597
          Length = 305

 Score =  114 bits (274), Expect = 4e-26
 Identities = 54/82 (65%), Positives = 64/82 (78%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAAR +VAIENP D+ V S+R +GQRAVLKFA +TGA  IAGR TPG FTNQ+Q +F
Sbjct: 61  KLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSF 120

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E++
Sbjct: 121 SEPRLLILTDPRTDHQPIKESA 142



 Score = 81.4 bits (192), Expect = 3e-16
 Identities = 35/75 (46%), Positives = 47/75 (62%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TDSP+ +VDI IP N K  +SIG ++W                  WDV+VDL
Sbjct: 146 IPTIAFCDTDSPMRYVDIGIPANNKGRNSIGCLFWLLARMVLQMRGTILPGHKWDVMVDL 205

Query: 437 FFYRDPEESEKDEQQ 481
           FFYRDPEE+++ E++
Sbjct: 206 FFYRDPEEAKEQEEE 220


>05_07_0129 -
           27886738-27886767,27887043-27887312,27888407-27888482,
           27889148-27889962
          Length = 396

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -3

Query: 342 EWEDLVLHGIAMSTNXSGESVLXKAITG 259
           EW++L+L G A+++  SGE  L  A  G
Sbjct: 72  EWDELLLSGAALASESSGELQLVAASPG 99


>05_01_0127 - 863755-865182
          Length = 475

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = -2

Query: 199 KRRGSRNAAWIWLVKAPGVKRPAIGVAPVXAANFSTAR*P 80
           KRR   +A  ++ +  PG  RP  G  P  AA+   A  P
Sbjct: 209 KRRNGEHACEVYTLGKPGGWRPCAGRVPASAASILPAMPP 248


>10_08_0492 +
           18292208-18292248,18292874-18293365,18294139-18294319,
           18294388-18294442,18294473-18294592,18295335-18295465,
           18295691-18295891
          Length = 406

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = -1

Query: 170 DLVSKSTWCETSRNRRSTGVXGKLQYSTLT 81
           DLVS+  +CE S+ + +    GKL ++ +T
Sbjct: 246 DLVSRQLFCENSKQKGADDSSGKLFFAEVT 275


>06_03_0424 - 20648938-20649564,20650588-20650902
          Length = 313

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +1

Query: 43  TPLMCSSSHHGPSVSVLY*SLP 108
           TP   SSSHH P +S L+  LP
Sbjct: 75  TPSSISSSHHTPPLSALHIMLP 96


>05_03_0609 -
           16161801-16162848,16163525-16163682,16163806-16163835,
           16164242-16164323,16164599-16164672
          Length = 463

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 15/43 (34%), Positives = 17/43 (39%)
 Frame = -2

Query: 409 VTGKHTTKPXXFTCQQPPHQTNRVGRLGVAWDSNVHKX*WGVC 281
           V  + T K      + PP Q  RVG  GV      H   WG C
Sbjct: 3   VDQRTTAKAIMPPVEMPPVQPGRVGLWGVTVRCRDHGRCWGFC 45


>04_04_1331 -
           32706043-32707248,32707411-32707652,32707737-32708562,
           32708640-32708863,32708946-32709262,32709381-32709443,
           32709465-32709640,32710609-32710985,32711416-32711470,
           32711614-32711913
          Length = 1261

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +2

Query: 425 VVDLFFYRDPEESEK 469
           ++D+F+YRDP E EK
Sbjct: 721 MLDVFYYRDPNEMEK 735


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,900,961
Number of Sequences: 37544
Number of extensions: 248400
Number of successful extensions: 551
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 549
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 987904180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -