SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0543 - 18649894-18650233,18651446-18651981                       88   7e-18
02_05_0089 - 25715637-25716333,25716481-25717238                       87   1e-17
10_08_0544 - 18655186-18655567,18656835-18657151                       87   2e-17
03_02_0826 + 11569961-11570301,11572220-11572454                       81   6e-16
02_05_1047 + 33745656-33745964                                         78   6e-15
03_02_0079 + 5485090-5485238,5486066-5486137,5486764-5486840,548...    33   0.21 
03_01_0604 + 4449416-4449766,4450150-4450374                           29   2.6  
03_01_0314 - 2477593-2480685                                           29   4.5  
01_06_0011 - 25559099-25559238,25559781-25559814,25560172-255603...    28   6.0  
12_01_0981 + 9931542-9931606,9931779-9933105                           28   7.9  
02_04_0298 - 21733620-21733805,21733900-21734025,21734128-217342...    28   7.9  
01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702...    28   7.9  

>10_08_0543 - 18649894-18650233,18651446-18651981
          Length = 291

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 40/84 (47%), Positives = 59/84 (70%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +TA EL QYDG+     +LMA+ G I+DV++   FYGPGGPYA+F G+DA+R LA  S  
Sbjct: 147 ITAEELLQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAGKDASRALAKMSF- 205

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
            P+   DD+S L+ +E+ ++++WE
Sbjct: 206 EPQDLTDDISGLSLLELSALQDWE 229


>02_05_0089 - 25715637-25716333,25716481-25717238
          Length = 484

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 41/84 (48%), Positives = 55/84 (65%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  ELR YDG+     +LMA+ G I+DVT+   FYGPGGPYA+F GRDA+R LA  S  
Sbjct: 221 VTEEELRVYDGSDPNKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGRDASRALAKMSFE 280

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
             +    D+S L  +E+E++ EWE
Sbjct: 281 LDDLT-GDVSGLGPIELEALHEWE 303


>10_08_0544 - 18655186-18655567,18656835-18657151
          Length = 232

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           ELRQYDG+     +LMA+ G I+DVT+   FYGPGGPYA+F G+DA+R LA  S   P+ 
Sbjct: 78  ELRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSF-EPQD 136

Query: 447 DYDDLSDLNSMEMESVREWE 506
              D+S L   E++++++WE
Sbjct: 137 LTGDISGLGPFELDALQDWE 156


>03_02_0826 + 11569961-11570301,11572220-11572454
          Length = 191

 Score = 81.4 bits (192), Expect = 6e-16
 Identities = 39/88 (44%), Positives = 53/88 (60%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  +L  YDG      +L+A+ G ++DVTRG  FYGP GPY++F GRDATR LA  S  
Sbjct: 82  ITLEQLAAYDGKDPAKPILIAIRGQVYDVTRGRLFYGPQGPYSLFAGRDATRALALMSFD 141

Query: 435 APEKDYDDLSDLNSMEMESVREWEDNLE 518
            P     DL  L   E+E +++WED  +
Sbjct: 142 -PIDLTGDLDGLGPDELEVLQDWEDKFK 168


>02_05_1047 + 33745656-33745964
          Length = 102

 Score = 78.2 bits (184), Expect = 6e-15
 Identities = 37/92 (40%), Positives = 54/92 (58%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +A  +TA +LR YDG+     + ++V G ++DVT G  FYGPGG YAVF GR+A+R L  
Sbjct: 1   MAAELTAAQLRAYDGSDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGK 60

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
            S    +    DLS L+  E+  + +WE   +
Sbjct: 61  MSKDDADVS-GDLSGLSDKELGVLADWETKFQ 91


>03_02_0079 +
           5485090-5485238,5486066-5486137,5486764-5486840,
           5486946-5486989,5487583-5487639,5487640-5487686,
           5488010-5488184,5489501-5489662,5489845-5489883
          Length = 273

 Score = 33.1 bits (72), Expect = 0.21
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +3

Query: 330 IFDVTRGNRFYGPGGPYAVFGG 395
           +FDVT+G   YGPGG Y  F G
Sbjct: 52  VFDVTKGKSNYGPGGGYHHFAG 73


>03_01_0604 + 4449416-4449766,4450150-4450374
          Length = 191

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +2

Query: 539 RLLRPGEEPRNYSDEEPEEADTSALPNDDKENQIGTFIAK 658
           RL R G   R + D+EPEE DTS +   D   + G  + +
Sbjct: 15  RLRRRGAA-RRWLDDEPEEKDTSCMTTGDGGGEFGRSVVE 53


>03_01_0314 - 2477593-2480685
          Length = 1030

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +2

Query: 296 GWQSVDGCEWVDIRCD*RESV 358
           GW S   C W  +RCD R +V
Sbjct: 50  GWSSAPHCTWKGVRCDARGAV 70


>01_06_0011 -
           25559099-25559238,25559781-25559814,25560172-25560333,
           25560335-25560454
          Length = 151

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +2

Query: 302 QSVDGCEWVDIRCD 343
           Q VD C W D+RCD
Sbjct: 129 QDVDPCNWKDVRCD 142


>12_01_0981 + 9931542-9931606,9931779-9933105
          Length = 463

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 18/66 (27%), Positives = 26/66 (39%)
 Frame = -1

Query: 475 ELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPP 296
           +L+S K     +    EN+   +  SL       PP P N  P    N   F   +T+PP
Sbjct: 15  KLKSTKMRNMSNSPNQENIEMTMTPSLVTTLPLPPPPP-NHIPTTERNTSVFFNTSTIPP 73

Query: 295 SCVPSY 278
              P +
Sbjct: 74  PPPPHF 79


>02_04_0298 -
           21733620-21733805,21733900-21734025,21734128-21734213,
           21734751-21734866,21734951-21735628,21736080-21736105
          Length = 405

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +2

Query: 524 YDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKENQ 637
           +D+V  L     EP+ Y D +P + D +  P DDK ++
Sbjct: 57  HDVVPGLEWDDTEPKVYEDPKPAKDDVNQPPVDDKTSE 94


>01_06_1827 +
           40169001-40169263,40169358-40169472,40170090-40170201,
           40170556-40170623,40170798-40170852,40170948-40171027,
           40171811-40171924,40172178-40172296,40173064-40173181,
           40173264-40173394,40173535-40173688,40173922-40174017
          Length = 474

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -1

Query: 394 PPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCRSSTAVI 254
           PP  A  PP P    P+V       TA  TLPP   P+   S++  +
Sbjct: 35  PPPPAPPPPPPPRLEPVVVVAPSTTTATATLPPIITPTLSPSTSTCL 81


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,907,683
Number of Sequences: 37544
Number of extensions: 406740
Number of successful extensions: 1203
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1147
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1199
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1721314888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -